Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Erythropoietin/EPO, Human (CHO)

Erythropoietin/EPO is a renal cytokine that activates Akt and NF-κB signaling pathways by binding to erythroid progenitor cells EPOR. Erythropoietin/EPO regulates erythroid proliferation and differentiation and inhibits apoptosis. Erythropoietin/EPO also has angiogenic ability comparable to VEGF and can stimulate endothelial cell capillary sprouting. Erythropoietin/EPO can be used in the study of ischemic heart diseases such as anemia in end-stage renal disease. Erythropoietin/EPO Protein, Human (CHO) is a recombinant Erythropoietin/EPO protein expressed in CHO cells with tag-free.

Product Specifications

Product Name Alternative

Erythropoietin/EPO Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/erythropoietin-epo-protein-human-cho.html

Purity

98.00

Smiles

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Molecular Formula

2056 (Gene_ID) P01588 (A28-R193) (Accession)

Molecular Weight

Approximately 26-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Calvillo L, et al. Recombinant human erythropoietin protects the myocardium from ischemia-reperfusion injury and promotes beneficial remodeling. Proc Natl Acad Sci U S A. 2003 Apr 15;100 (8) :4802-6.|[2]Jaquet K, et al. Erythropoietin and VEGF exhibit equal angiogenic potential. Microvasc Res. 2002 Sep;64 (2) :326-33.|[3]Stephenson JR, et al. Induction of colonies of hemoglobin-synthesizing cells by erythropoietin in vitro. Proc Natl Acad Sci U S A. 1971 Jul;68 (7) :1542-6.|[4]Kato M, et al. Pharmacokinetics and pharmacodynamics of recombinant human erythropoietin in rats. Arzneimittelforschung. 2001 Jan;51 (1) :91-5.|[5]Kato M, et al. Mechanism for the nonlinear pharmacokinetics of erythropoietin in rats. J Pharmacol Exp Ther. 1997 Nov;283 (2) :520-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-500 1x 500 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-100 1x 100 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details