UBE2R2, Human (His)
The UBE2R2 protein is a key element of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to a variety of protein substrates. UBE2R2 Protein, Human (His) is the recombinant human-derived UBE2R2 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
UBE2R2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ube2r2-protein-human-his.html
Smiles
MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES
Molecular Formula
54926 (Gene_ID) Q712K3 (M1-S238) (Accession)
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AE62944SH-01 48 Tests
Sheep 5-hydroxytryptamine/serotonin (5HT/ST) ELISA Kit
Sign In for Pricing
View Details AE62944SH-02 96 Tests
Sheep 5-hydroxytryptamine/serotonin (5HT/ST) ELISA Kit
Sign In for Pricing
View Details 