Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2R2, Human (His)

The UBE2R2 protein is a key element of the ubiquitin-proteasome system and functions as an E2 ubiquitin-conjugating enzyme. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to a variety of protein substrates. UBE2R2 Protein, Human (His) is the recombinant human-derived UBE2R2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2R2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2r2-protein-human-his.html

Smiles

MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES

Molecular Formula

54926 (Gene_ID) Q712K3 (M1-S238) (Accession)

Molecular Weight

Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caulobacter crescentus Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS), partial
MBS1432634 Inquire

Recombinant Caulobacter crescentus Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS), partial

Sign In for Pricing
View Details
ALS2CR12 sgRNA CRISPR Lentivector (Human) (Target 3)
K0078104 1.0 µg DNA

ALS2CR12 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Lactococcus lactis subsp. lactis Lactococcin-A immunity protein (lciA)
MBS1031757-01 0.02 mg (E-Coli)

Recombinant Lactococcus lactis subsp. lactis Lactococcin-A immunity protein (lciA)

Sign In for Pricing
View Details
Recombinant Lactococcus lactis subsp. lactis Lactococcin-A immunity protein (lciA)
MBS1031757-02 0.1 mg (E-Coli)

Recombinant Lactococcus lactis subsp. lactis Lactococcin-A immunity protein (lciA)

Sign In for Pricing
View Details
Recombinant Lactococcus lactis subsp. lactis Lactococcin-A immunity protein (lciA)
MBS1031757-03 0.02 mg (Yeast)

Recombinant Lactococcus lactis subsp. lactis Lactococcin-A immunity protein (lciA)

Sign In for Pricing
View Details
Recombinant Lactococcus lactis subsp. lactis Lactococcin-A immunity protein (lciA)
MBS1031757-04 0.1 mg (Yeast)

Recombinant Lactococcus lactis subsp. lactis Lactococcin-A immunity protein (lciA)

Sign In for Pricing
View Details