Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Protein L1/VACWR088, Vaccinia virus (sf9, His, myc)

Protein L1/VACWR088 is a crucial part of the entry fusion complex (EFC) comprising 11 proteins. It facilitates the entry of the virion core into the host cytoplasm through a two-step process involving lipid mixing and pore formation. All EFC proteins, except OPG095/L1 and OPG053/F9, contribute to the assembly or stability of the complex. Protein L1/VACWR088, Vaccinia virus (sf9, His, myc) is the recombinant Virus-derived protein L1/VACWR088, expressed by sf9 insect cells , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Protein L1/VACWR088, Vaccinia virus (sf9, His, myc), Virus, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-l1-vacwr088-vaccinia-virus-sf9-his-myc.html

Purity

90.00

Smiles

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Molecular Formula

3707544 (Gene_ID) P07612 (G2-G183) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP5E Antibody, HRP conjugated
A68451-50UG 50 µg

INPP5E Antibody, HRP conjugated

Sign In for Pricing
View Details
Human MTA2 siRNA
abx924854-01 15 nmol

Human MTA2 siRNA

Sign In for Pricing
View Details
Human MTA2 siRNA
abx924854-02 30 nmol

Human MTA2 siRNA

Sign In for Pricing
View Details
Aminoadipate aminotransferase (AADAT) Human siRNA Oligo Duplex (Locus ID 51166)
SR309589 1 Kit

Aminoadipate aminotransferase (AADAT) Human siRNA Oligo Duplex (Locus ID 51166)

Sign In for Pricing
View Details
Ubiquitin Specific Peptidase 7 (USP7) Magnetic Fluorescence Assay Kit
MBS2158469-01 96 Tests

Ubiquitin Specific Peptidase 7 (USP7) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Ubiquitin Specific Peptidase 7 (USP7) Magnetic Fluorescence Assay Kit
MBS2158469-02 5x 96 Tests

Ubiquitin Specific Peptidase 7 (USP7) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details