Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Apolipoprotein E (Apoe)

Product Specifications

Product Name Alternative

Apo-E

Abbreviation

Recombinant Mouse Apoe protein

Gene Name

Apoe

UniProt

P08226

Expression Region

19-311aa

Organism

Mus musculus (Mouse)

Target Sequence

EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

APOE is an apolipoprotein, a protein associating with lipid particles, that mainly functions in lipoprotein-mediated lipid transport between organs via the plasma and interstitial fluids. APOE is a core component of plasma lipoproteins and is involved in their production, conversion and clearance. Apoliproteins are amphipathic molecules that interact both with lipids of the lipoprotein particle core and the aqueous environment of the plasma. As such, APOE associates with chylomicrons, chylomicron remnants, very low density lipoproteins and intermediate density lipoproteins but shows a preferential binding to high-density lipoproteins. It also binds a wide range of cellular receptors including the LDL receptor/LDLR and the very low-density lipoprotein receptor/VLDLR that mediate the cellular uptake of the APOE-containing lipoprotein particles. Finally, APOE has also a heparin-binding activity and binds heparan-sulfate proteoglycans on the surface of cells, a property that supports the capture and the receptor-mediated uptake of APOE-containing lipoproteins by cells

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39 kDa

References & Citations

"Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications." Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P. Biochim. Biophys. Acta 1764:1363-1371 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MAX (S2) Antibody
MBS7119828-01 0.05 mg

Phospho-MAX (S2) Antibody

Sign In for Pricing
View Details
Phospho-MAX (S2) Antibody
MBS7119828-02 0.1 mg

Phospho-MAX (S2) Antibody

Sign In for Pricing
View Details
Phospho-MAX (S2) Antibody
MBS7119828-03 5x 0.1 mg

Phospho-MAX (S2) Antibody

Sign In for Pricing
View Details
PMEL Recombinant Rabbit mAb, BF488 conjugated
orb3164154 100 µL

PMEL Recombinant Rabbit mAb, BF488 conjugated

Sign In for Pricing
View Details
CRX (Cone-rod Homeobox, CORD2, CRD, LCA7, OTX3) (FITC)
244945-FITC 100 µL

CRX (Cone-rod Homeobox, CORD2, CRD, LCA7, OTX3) (FITC)

Sign In for Pricing
View Details
CD11a (Integrin alpha-L, CD11 Antigen-like Family Member A, Leukocyte Adhesion Glycoprotein LFA-1 alpha Chain, LFA-1A, Leukocyte Function-associated Molecule 1 alpha Chain) (Biotin) discontinued
137621 100 Tests

CD11a (Integrin alpha-L, CD11 Antigen-like Family Member A, Leukocyte Adhesion Glycoprotein LFA-1 alpha Chain, LFA-1A, Leukocyte Function-associated Molecule 1 alpha Chain) (Biotin) discontinued

Sign In for Pricing
View Details