Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin B (CTSB)

Product Specifications

Product Name Alternative

(APP secretase) (APPS) (Cathepsin B1)

Abbreviation

Recombinant Human CTSB protein

Gene Name

CTSB

UniProt

P07858

Expression Region

18-339aa

Organism

Homo sapiens (Human)

Target Sequence

RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobulin in the thyroid follicle lumen. Has also been implicated in tumor invasion and metastasis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.9 kDa

References & Citations

Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.DNA Res. 12:117-126 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Levomenol
TRC-L375800-5G 5 g

Levomenol

Sign In for Pricing
View Details
Lemzoparlimab Biosimilar - Research Grade
ICH5034-1mg 1 mg

Lemzoparlimab Biosimilar - Research Grade

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) (NM_003406) Human Over-expression Lysate
LY401160 100 µg

14-3-3 zeta (YWHAZ) (NM_003406) Human Over-expression Lysate

Sign In for Pricing
View Details
ATF2 pThr71/53 Rabbit Polyclonal Antibody
AP02332PU-S 50 µL

ATF2 pThr71/53 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ampulla of Vater
CS702904 5x 5 µm

Tissue FFPE Sections, Ampulla of Vater

Sign In for Pricing
View Details
Recombinant Mucin-1 Antibody
RC-4829-01 50 μL

Recombinant Mucin-1 Antibody

Sign In for Pricing
View Details