Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OX40/TNFRSF4, Human (HEK293, His)

OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40/TNFRSF4 Protein, Human (HEK293, His) is a recombinant human OX40 (L29-A216) with C-terminal His tag, which is produced in HEK293.

Product Specifications

Product Name Alternative

OX40/TNFRSF4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/ox40-tnfrsf4-protein-human-hek293-his.html

Purity

95.0

Smiles

LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAHHHHHH

Molecular Formula

7293 (Gene_ID) P43489 (L29-A216) (Accession)

Molecular Weight

38-45 kDa

References & Citations

[1]TNFRSF4 TNF receptor superfamily member 4 [ Homo sapiens (human) ]|[2]Kaur D, et al. OX40/OX40 ligand interactions in T-cell regulation and asthma. Chest. 2012 Feb;141 (2) :494-499.|[3]Fu N, et al. The OX40/OX40L Axis Regulates T Follicular Helper Cell Differentiation: Implications for Autoimmune Diseases. Front Immunol. 2021 Jun 21;12:670637.|[4]Buglio D, et al. HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma. Blood. 2011 Mar 10;117 (10) :2910-7.|[5]Kotani A, et al. Signaling of gp34 (OX40 ligand) induces vascular endothelial cells to produce a CC chemokine RANTES/CCL5. Immunol Lett. 2002 Oct 21;84 (1) :1-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-100 1x 100 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (6F-H2), CF647 conjugate, 0.1mg/mL
BNC470856-500 1x 500 µL

WT1 (Wilm's Tumor 1) (6F-H2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details