Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-8/CXCL8, Human (CHO)

Interleukin-8 (IL-8), also known as CXCL8 or NAP-1, is a pro-inflammatory CXC chemokine. IL-8 acts on human neutrophils via two receptors, CXCR1 and CXCR2. IL-8 has a conserved Glu-Leu-Arg (ELR) N-terminal motif, and is an agonist for CXCR1/CXCR2. IL-8 is produced by various cells including leukocytes, endothelial cells, and epithelial cells[1][2][3]. IL-8/CXCL8 Protein, Human (CHO) is produced in CHO cells, and consists of 77 amino acids (A23-S99) .

Product Specifications

Product Name Alternative

IL-8/CXCL8 Protein, Human (CHO), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-8-cxcl8-protein-human-cho.html

Purity

95.00

Smiles

AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Molecular Formula

3576 (Gene_ID) P10145 (A23-S99) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Baggiolini M, et al. Neutrophil-activating peptide-1/interleukin 8, a novel cytokine that activates neutrophils. J Clin Invest. 1989 Oct;84 (4) :1045-9.|[2]Koch AE, et al. Interleukin-8 as a macrophage-derived mediator of angiogenesis. Science. 1992 Dec 11;258 (5089) :1798-801.|[3]M Baggiolini, et al. Neutrophil-activating peptide-1/interleukin 8, a novel cytokine that activates neutrophils. J Clin Invest. 1989 Oct;84 (4) :1045-9.|[4]M Wolf, et al. Granulocyte chemotactic protein 2 acts via both IL-8 receptors, CXCR1 and CXCR2. Eur J Immunol. 1998 Jan;28 (1) :164-70.|[5]Qian Liu, et al. The CXCL8-CXCR1/2 pathways in cancer. Cytokine Growth Factor Rev. 2016 Oct;31:61-71.|[6]Jian-Feng Liu, et al. IL-8 Is Upregulated in the Tissue-Derived EVs of Odontogenic Keratocysts. Biomed Res Int. 2022 Jul 30;2022:9453270.|[7]Remo C Russo, et al. The CXCL8/IL-8 chemokine family and its receptors in inflammatory diseases. Expert Rev Clin Immunol. 2014 May;10 (5) :593-619.|[8]Hai Jiang, et al. CXCL8 promotes the invasion of human osteosarcoma cells by regulation of PI3K/Akt signaling pathway. APMIS. 2017 Sep;125 (9) :773-780.|[9]L Laterveer, et al. Rapid mobilization of hematopoietic progenitor cells in rhesus monkeys by a single intravenous injection of interleukin-8. Blood. 1996 Jan 15;87 (2) :781-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial dicarboxylate carrier (SLC25A10) (NM_001270953) Human Tagged ORF Clone
RC232673 10 µg

Mitochondrial dicarboxylate carrier (SLC25A10) (NM_001270953) Human Tagged ORF Clone

Sign In for Pricing
View Details
TBCK (TBC Domain-containing Protein Kinase-like Protein, TBCKL, HSPC302, MGC16169) (APC)
129625-APC 100 µL

TBCK (TBC Domain-containing Protein Kinase-like Protein, TBCKL, HSPC302, MGC16169) (APC)

Sign In for Pricing
View Details
Human EDAR ELISA Kit PicoKine®, Carrier-free
EK1851-carrier-free 96 Well With Removable Strips

Human EDAR ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
PAI-1 Peptide
45-142P 0.1 mg

PAI-1 Peptide

Sign In for Pricing
View Details
2610015P09Rik sgRNA CRISPR Lentivector set (Mouse)
K3115801 3x 1.0 µg

2610015P09Rik sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (A76) [Alexa Fluor 405]
NBP1-05170AF405 0.1 mL

Mouse Monoclonal Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody (A76) [Alexa Fluor 405]

Sign In for Pricing
View Details