Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF alpha/TGFA, Human

TGF-alpha Protein, Human is a 50-amino-acid polypeptide that binds to the epidermal growth factor (EGF) receptor and stimulates cell growth.

Product Specifications

Product Name Alternative

TGF alpha/TGFA Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgf-alpha-protein-human.html

Purity

95.00

Smiles

VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Molecular Formula

7039 (Gene_ID) P01135 (V40-A89) (Accession)

Molecular Weight

Approximately 5.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nilsson O, et al. Expression of transforming growth factor alpha and its receptor in human neuroendocrine tumours. Int J Cancer. 1995 Mar 3;60 (5) :645-51.|[2]Lupia E, et al. Thrombopoietin as biomarker and mediator of cardiovascular damage in critical diseases. Mediators Inflamm. 2012;2012:390892.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DuoClick™ Screw-Cap Culture Tubes
T8742 500 Units/Case

DuoClick™ Screw-Cap Culture Tubes

Sign In for Pricing
View Details
Talazoparib Tosylate
TRC-T137340-50MG 50 mg

Talazoparib Tosylate

Sign In for Pricing
View Details
PD-166285-d4
TRC-P217502-1MG 1 mg

PD-166285-d4

Sign In for Pricing
View Details
EnzyFluo™ Collagen Assay Kit
ECOL-100 100 Tests

EnzyFluo™ Collagen Assay Kit

Sign In for Pricing
View Details
ERBIN Rabbit Polyclonal Antibody
TA375957 100 µL

ERBIN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vitamin D3 Octanoate (90%)
TRC-V676105-50MG 50 mg

Vitamin D3 Octanoate (90%)

Sign In for Pricing
View Details