Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF alpha/TGFA, Human

TGF-alpha Protein, Human is a 50-amino-acid polypeptide that binds to the epidermal growth factor (EGF) receptor and stimulates cell growth.

Product Specifications

Product Name Alternative

TGF alpha/TGFA Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgf-alpha-protein-human.html

Purity

95.00

Smiles

VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Molecular Formula

7039 (Gene_ID) P01135 (V40-A89) (Accession)

Molecular Weight

Approximately 5.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nilsson O, et al. Expression of transforming growth factor alpha and its receptor in human neuroendocrine tumours. Int J Cancer. 1995 Mar 3;60 (5) :645-51.|[2]Lupia E, et al. Thrombopoietin as biomarker and mediator of cardiovascular damage in critical diseases. Mediators Inflamm. 2012;2012:390892.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

R-(-)-Arundic Acid
TRC-A779500-50MG 50 mg

R-(-)-Arundic Acid

Sign In for Pricing
View Details
C3 Antibody
KC-3288-01 50 μL

C3 Antibody

Sign In for Pricing
View Details
C3 Antibody
KC-3288-02 100 µL

C3 Antibody

Sign In for Pricing
View Details
C3 Antibody
KC-3288-03 1 mL

C3 Antibody

Sign In for Pricing
View Details
Dextran (Technical Grade~ 20K)
TRC-D299115-50G 50 g

Dextran (Technical Grade~ 20K)

Sign In for Pricing
View Details
Psoralen TMP Maleimide
39061-AAT 1 mg

Psoralen TMP Maleimide

Sign In for Pricing
View Details