Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF alpha/TGFA, Human

TGF-alpha Protein, Human is a 50-amino-acid polypeptide that binds to the epidermal growth factor (EGF) receptor and stimulates cell growth.

Product Specifications

Product Name Alternative

TGF alpha/TGFA Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgf-alpha-protein-human.html

Purity

95.00

Smiles

VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Molecular Formula

7039 (Gene_ID) P01135 (V40-A89) (Accession)

Molecular Weight

Approximately 5.8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Nilsson O, et al. Expression of transforming growth factor alpha and its receptor in human neuroendocrine tumours. Int J Cancer. 1995 Mar 3;60 (5) :645-51.|[2]Lupia E, et al. Thrombopoietin as biomarker and mediator of cardiovascular damage in critical diseases. Mediators Inflamm. 2012;2012:390892.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf80 (ANGPTL8) Mouse Monoclonal Antibody [Clone ID: OTI4F1]
CF807377 100 µg

C19orf80 (ANGPTL8) Mouse Monoclonal Antibody [Clone ID: OTI4F1]

Sign In for Pricing
View Details
Human SGSM3 activation kit by CRISPRa
GA109144 1 Kit

Human SGSM3 activation kit by CRISPRa

Sign In for Pricing
View Details
CD105 Rabbit Polyclonal Antibody
HA500266 100 µL

CD105 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(Z-DEVD) 2-R110
13430-AAT 1 mg

(Z-DEVD) 2-R110

Sign In for Pricing
View Details
Melanophilin (mLPH) Human Gene Knockout Kit (CRISPR)
KN400895 1 Kit

Melanophilin (mLPH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spef2 Mouse Gene Knockout Kit (CRISPR)
KN516590 1 Kit

Spef2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details