Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Human (CHO, His)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human (CHO, His) is a recombinant human IL-17A protein with His tag at the C-terminus and is expressed in CHO cells. It consists of 132 amino acids (G24-A155) .

Product Specifications

Product Name Alternative

IL-17A Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-human-cho-his.html

Purity

95.00

Smiles

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH

Molecular Formula

3605 (Gene_ID) Q16552 (G24-A155) (Accession)

Molecular Weight

Approximately 14-22 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Kinoshita H, et al. Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA. J Allergy Clin Immunol. 2009 Jan;123 (1) :179-86.|[6]Henness S, et al. IL-17A acts via p38 MAPK to increase stability of TNF-alpha-induced IL-8 mRNA in human ASM. Am J Physiol Lung Cell Mol Physiol. 2006 Jun;290 (6) :L1283-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm7694 (NM_001198955) Mouse Tagged ORF Clone
MR228916 10 µg

Gm7694 (NM_001198955) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RN5S373 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV745020 1.0 µg DNA

RN5S373 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
RAD1 Antibody (Center)
orb163743-01 50 µL

RAD1 Antibody (Center)

Sign In for Pricing
View Details
RAD1 Antibody (Center)
orb163743-02 100 µL

RAD1 Antibody (Center)

Sign In for Pricing
View Details
STX19 Antibody Blocking peptide
orb1459200 500 µg

STX19 Antibody Blocking peptide

Sign In for Pricing
View Details
25-OH VD3 (32F9C4), mAb, Mouse
V00101-0.1 100 µg

25-OH VD3 (32F9C4), mAb, Mouse

Sign In for Pricing
View Details