Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Human (CHO, His)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human (CHO, His) is a recombinant human IL-17A protein with His tag at the C-terminus and is expressed in CHO cells. It consists of 132 amino acids (G24-A155) .

Product Specifications

Product Name Alternative

IL-17A Protein, Human (CHO, His), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-human-cho-his.html

Purity

95.00

Smiles

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH

Molecular Formula

3605 (Gene_ID) Q16552 (G24-A155) (Accession)

Molecular Weight

Approximately 14-22 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chen K, et al. Interluekin-17A (IL17A) . Gene. 2017 May 30;614:8-14.|[2]Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.|[3]Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10 (7) :479-89.|[4]Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181 (4) :2799-805.|[5]Kinoshita H, et al. Cytokine milieu modulates release of thymic stromal lymphopoietin from human keratinocytes stimulated with double-stranded RNA. J Allergy Clin Immunol. 2009 Jan;123 (1) :179-86.|[6]Henness S, et al. IL-17A acts via p38 MAPK to increase stability of TNF-alpha-induced IL-8 mRNA in human ASM. Am J Physiol Lung Cell Mol Physiol. 2006 Jun;290 (6) :L1283-90.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnls Rat Pre-designed siRNA Set A
HY-RS25120 1 Set

Rnls Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
TCTN1 Rabbit Polyclonal Antibody (PerCP)
orb2535515 100 µL

TCTN1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Anti-DGAT1 antibody
STJ117535 100 µl

Anti-DGAT1 antibody

Sign In for Pricing
View Details
Klhl1 (NM_053105) Mouse Tagged ORF Clone Lentiviral Particle
MR210464L3V 200 µL

Klhl1 (NM_053105) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Granzyme K (GZMK) Monoclonal Antibody
CAU34634-01 100 µL

Granzyme K (GZMK) Monoclonal Antibody

Sign In for Pricing
View Details
Granzyme K (GZMK) Monoclonal Antibody
CAU34634-02 200 µL

Granzyme K (GZMK) Monoclonal Antibody

Sign In for Pricing
View Details