IL-17A, Human (CHO, His)
IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human (CHO, His) is a recombinant human IL-17A protein with His tag at the C-terminus and is expressed in CHO cells. It consists of 132 amino acids (G24-A155) .
Product Specifications
Product Name Alternative
IL-17A Protein, Human (CHO, His), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-17a-protein-human-cho-his.html
Purity
95.00
Smiles
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH
Molecular Formula
3605 (Gene_ID) Q16552 (G24-A155) (Accession)
Molecular Weight
Approximately 14-22 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Goose Translationally Controlled Tumor Protein (TCTP) ELISA Kit
CD24 (Signal Transducer CD24, Small Cell Lung Carcinoma Cluster 4 Antigen, CD24A) (APC)
