Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGR1/ZNF225, Human (His)

The EGR1/ZNF225 protein is a multifunctional transcriptional regulator that binds to the EGR site in the promoter of target genes and is independent of cytosine methylation. It controls the transcription of multiple target genes, affecting responses to growth factors, DNA damage, and ischemia. EGR1/ZNF225 Protein, Human (His) is the recombinant human-derived EGR1/ZNF225 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

EGR1/ZNF225 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egr1-znf225-protein-human-his.html

Purity

97.00

Smiles

QQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS

Molecular Formula

1958 (Gene_ID) P18146 (Q282-S433) (Accession)

Molecular Weight

Approximately 20.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Aldh9a1 (NM_019993) AAV Particle
MR207926A1V 250 µL

Mouse Aldh9a1 (NM_019993) AAV Particle

Sign In for Pricing
View Details
Hsp105 (HSPH1) (NM_006644) Human Tagged ORF Clone Lentiviral Particle
RC207102L3V 200 µL

Hsp105 (HSPH1) (NM_006644) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CEACAM19 Human shRNA Lentiviral Particle (Locus ID 56971)
TL305461V 500 µL Each

CEACAM19 Human shRNA Lentiviral Particle (Locus ID 56971)

Sign In for Pricing
View Details
DGCR6 Double Nickase Plasmid (h)
sc-411128-NIC 20 µg

DGCR6 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
PEX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36401061 1.0 µg DNA

PEX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human DS -Dermatan Sulfate- CLIA Kit
E-CL-H1083-01 24 Tests

Human DS -Dermatan Sulfate- CLIA Kit

Sign In for Pricing
View Details