Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal S1P5/EDG-8 Antibody (1196A) [PE/Atto594]
FAB9084PEATT594 0.1 mL

Rabbit Monoclonal S1P5/EDG-8 Antibody (1196A) [PE/Atto594]

Sign In for Pricing
View Details
SPC24 Protein Vector (Mouse) (pPM-C-HA)
45241024 500 ng

SPC24 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Ras-related protein Rab-20, Rab20 ELISA KIT
ELI-30461m 96 Tests

Mouse Ras-related protein Rab-20, Rab20 ELISA KIT

Sign In for Pricing
View Details
Human SLC35C1 knockdown cell line
ABC-KD14061 1 Vial

Human SLC35C1 knockdown cell line

Sign In for Pricing
View Details
CD8 Antibody
GWB-5A1B2A 0.02 mg

CD8 Antibody

Sign In for Pricing
View Details
C3AR1 Polyclonal Antibody
RD252181A-01 20 µL

C3AR1 Polyclonal Antibody

Sign In for Pricing
View Details