Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Coronavirus 229E Nucleoprotein (HCoV-229E N) Antibody
abx377734-01 50 µg

Human Coronavirus 229E Nucleoprotein (HCoV-229E N) Antibody

Sign In for Pricing
View Details
Human Coronavirus 229E Nucleoprotein (HCoV-229E N) Antibody
abx377734-02 100 µg

Human Coronavirus 229E Nucleoprotein (HCoV-229E N) Antibody

Sign In for Pricing
View Details
MTMR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1362607 1.0 µg DNA

MTMR3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Aurora A (AURKA) (NM_198436) Human Tagged ORF Clone
RG206572 10 µg

Aurora A (AURKA) (NM_198436) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human TNR Pre-designed siRNA Set B
SI017131B 1 Each

Human TNR Pre-designed siRNA Set B

Sign In for Pricing
View Details
PPARD, CT (PPARD, NR1C2, PPARB, Peroxisome proliferator-activated receptor delta, NUCI, Nuclear hormone receptor 1, Nuclear receptor subfamily 1 group C member 2, Peroxisome proliferator-activated receptor beta) (MaxLight 405) discontinued
040301-ML405 100 µL

PPARD, CT (PPARD, NR1C2, PPARB, Peroxisome proliferator-activated receptor delta, NUCI, Nuclear hormone receptor 1, Nuclear receptor subfamily 1 group C member 2, Peroxisome proliferator-activated receptor beta) (MaxLight 405) discontinued

Sign In for Pricing
View Details