Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ADP-ribosylation factor-like protein 1, GST, E.coli-200ug
QP8356-ec-200ug 200ug

Recombinant Human ADP-ribosylation factor-like protein 1, GST, E.coli-200ug

Sign In for Pricing
View Details
2-Cyano-2-propanol-1,1,1,3,3,3-d6
MBS6099100-01 10 mg

2-Cyano-2-propanol-1,1,1,3,3,3-d6

Sign In for Pricing
View Details
2-Cyano-2-propanol-1,1,1,3,3,3-d6
MBS6099100-02 5x 10 mg

2-Cyano-2-propanol-1,1,1,3,3,3-d6

Sign In for Pricing
View Details
BRAF (v-raf murine Sarcoma Viral Oncogene Homolog B1, B-RAF1, BRAF1, FLJ95109, MGC126806, MGC138284, RAFB1) (MaxLight 550)
243870-ML550 100 µL

BRAF (v-raf murine Sarcoma Viral Oncogene Homolog B1, B-RAF1, BRAF1, FLJ95109, MGC126806, MGC138284, RAFB1) (MaxLight 550)

Sign In for Pricing
View Details
Vom1r11 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6283602 1.0 µg DNA

Vom1r11 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Homeobox protein prophet of Pit-1 (PROP1) Human ELISA Kit
E1145 96 Tests

Homeobox protein prophet of Pit-1 (PROP1) Human ELISA Kit

Sign In for Pricing
View Details