Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tamias bulleri Cytochrome c oxidase subunit 2 (MT-CO2), partial
MBS7090492 Inquire

Recombinant Tamias bulleri Cytochrome c oxidase subunit 2 (MT-CO2), partial

Sign In for Pricing
View Details
IGFBP3 (NM_000598) Human Tagged ORF Clone
RC209150 10 µg

IGFBP3 (NM_000598) Human Tagged ORF Clone

Sign In for Pricing
View Details
Versican (VCAN) Antibody (Streptavidin)
abx444693 100 µg

Versican (VCAN) Antibody (Streptavidin)

Sign In for Pricing
View Details
FRA13B sgRNA CRISPR Lentivector set (Human)
K0809401 3x 1.0 µg

FRA13B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Dnajb13 Mouse shRNA Plasmid (Locus ID 69387)
TR510105 1 Kit

Dnajb13 Mouse shRNA Plasmid (Locus ID 69387)

Sign In for Pricing
View Details
SNRNP70 Polyclonal Antibody
MBS9126916-01 0.02 mL

SNRNP70 Polyclonal Antibody

Sign In for Pricing
View Details