Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS12 Antibody
MBS7131578-01 0.1 mL

RGS12 Antibody

Sign In for Pricing
View Details
RGS12 Antibody
MBS7131578-02 5x 0.1 mL

RGS12 Antibody

Sign In for Pricing
View Details
Protein Phosphatase 2A, Serine, Threonine (PP2A Ser/Thr) (MaxLight 550)
P9107-33-ML550 100 µL

Protein Phosphatase 2A, Serine, Threonine (PP2A Ser/Thr) (MaxLight 550)

Sign In for Pricing
View Details
TSPAN4 (NM_001025234) Human Tagged ORF Clone Lentiviral Particle
RC210590L4V 200 µL

TSPAN4 (NM_001025234) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
EXTL3 (NM_001440) Human Tagged ORF Clone
RG202899 10 µg

EXTL3 (NM_001440) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae Carkd Protein (aa 1-337) [His]
VAng-Wyb4357-1mg 1 mg

Recombinant Saccharomyces Cerevisiae Carkd Protein (aa 1-337) [His]

Sign In for Pricing
View Details