Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal FUCA2 Antibody (ascites), Clone: 234CT20.2.1
AMM04635G 0.1 ml

Monoclonal FUCA2 Antibody (ascites), Clone: 234CT20.2.1

Sign In for Pricing
View Details
Col5a1 Mouse shRNA Lentiviral Particle (Locus ID 12831)
TL509546V 500 µL Each

Col5a1 Mouse shRNA Lentiviral Particle (Locus ID 12831)

Sign In for Pricing
View Details
Rabbit Monoclonal L-Selectin/CD62L Antibody (MEL-14) [Alexa Fluor 488]
NBP2-81083AF488 0.1 mL

Rabbit Monoclonal L-Selectin/CD62L Antibody (MEL-14) [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Escherichia coli UPF0410 protein yeaQ (yeaQ), partial
MBS7061917 Inquire

Recombinant Escherichia coli UPF0410 protein yeaQ (yeaQ), partial

Sign In for Pricing
View Details
Surfactant Associated Protein A (SPA) Antibody
abx174677-01 200 µg

Surfactant Associated Protein A (SPA) Antibody

Sign In for Pricing
View Details
Surfactant Associated Protein A (SPA) Antibody
abx174677-02 1 mg

Surfactant Associated Protein A (SPA) Antibody

Sign In for Pricing
View Details