Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BubR1 Antibody (OTI6E5) [DyLight 405]
NBP2-70314V 0.1 mL

Mouse Monoclonal BubR1 Antibody (OTI6E5) [DyLight 405]

Sign In for Pricing
View Details
RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (FITC)
MBS6340721-01 0.2 mL

RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (FITC)

Sign In for Pricing
View Details
RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (FITC)
MBS6340721-02 5x 0.2 mL

RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (FITC)

Sign In for Pricing
View Details
F11R/JAM-A/CD321 Recombinant Antibody, APC-Cy7 Conjugated
bsm-52561R-APC-Cy7 100 µL

F11R/JAM-A/CD321 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida PM0444 Protein (aa 1-83)
VAng-Cr7078-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida PM0444 Protein (aa 1-83)

Sign In for Pricing
View Details
Bovine anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit
MBS7275026-01 48 Well

Bovine anti-Zona Pellucida Glycoprotein 2 Antibody ELISA Kit

Sign In for Pricing
View Details