Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal TRAILR2/TNFRSF10B Antibody (drozitumab) [Janelia Fluor 635]
NBP3-28785JF635 0.1 mL

Human Monoclonal TRAILR2/TNFRSF10B Antibody (drozitumab) [Janelia Fluor 635]

Sign In for Pricing
View Details
Cell Division Cycle Protein 16 (Cdc16) Antibody
abx149113 100 µg

Cell Division Cycle Protein 16 (Cdc16) Antibody

Sign In for Pricing
View Details
DBH Peptide
DF7060-BP 1 mg

DBH Peptide

Sign In for Pricing
View Details
2-Phenylethynyl-phenylamine
sc-321872 1 g

2-Phenylethynyl-phenylamine

Sign In for Pricing
View Details
Recombinant Rhesus Macaque PNPO Protein, His (Fc)-Avi-tagged
PNPO-3315R 50 µg

Recombinant Rhesus Macaque PNPO Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
C17orf75 sgRNA CRISPR Lentivector (Human) (Target 2)
K0320503 1.0 µg DNA

C17orf75 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details