Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF180 ORF Vector (Human) (pORF)
40272011 1.0 µg DNA

RNF180 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
C19orf54 Peptide - N-terminal region
MBS3237395-01 0.1 mg

C19orf54 Peptide - N-terminal region

Sign In for Pricing
View Details
C19orf54 Peptide - N-terminal region
MBS3237395-02 5x 0.1 mg

C19orf54 Peptide - N-terminal region

Sign In for Pricing
View Details
EDG8 (S1PR5) (NM_001166215) Human Untagged Clone
SC327509 10 µg

EDG8 (S1PR5) (NM_001166215) Human Untagged Clone

Sign In for Pricing
View Details
Vmn2r74 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
49819064 1.0 µg DNA

Vmn2r74 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mitochondrial import inner membrane translocase subunit Tim23 (TIMM23) Bovine ELISA Kit
F0270 96 Tests

Mitochondrial import inner membrane translocase subunit Tim23 (TIMM23) Bovine ELISA Kit

Sign In for Pricing
View Details