Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPR182 Pre-designed siRNA Set A
SI006535A 1 Each

Human GPR182 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse C1qc shRNA (UAS) - Lentiviral mouseC1qc shRNA (UAS, GFP) (25)
GTR15175784 1 Vial

Lentiviral mouse C1qc shRNA (UAS) - Lentiviral mouseC1qc shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Human UPK1B Knockout HEK293T cell line
GTR15409091 1 Vial

Human UPK1B Knockout HEK293T cell line

Sign In for Pricing
View Details
Odf4 Rat shRNA Plasmid (Locus ID 303236)
TR700857 1 Kit

Odf4 Rat shRNA Plasmid (Locus ID 303236)

Sign In for Pricing
View Details
Olr661 sgRNA CRISPR Lentivector set (Rat)
K7279401 3x 1.0 µg

Olr661 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
UPB1 siRNA (Rat)
MBS8240350-01 15 nmol

UPB1 siRNA (Rat)

Sign In for Pricing
View Details