Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
37841151 3x 1.0 µg DNA

PRSS3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rabbit Monoclonal CEACAM6/CD66c Antibody (111) [Janelia Fluor 549]
NBP2-89672JF549 0.1 mL

Rabbit Monoclonal CEACAM6/CD66c Antibody (111) [Janelia Fluor 549]

Sign In for Pricing
View Details
SEC23IP, CT (SEC23IP, SEC23-interacting protein, p125) (MaxLight 490) discontinued
041516-ML490 100 µL

SEC23IP, CT (SEC23IP, SEC23-interacting protein, p125) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse Anti-Glycoprotein 210 Antibody AGPA ELISA Kit
BG-MUS10085 1 Each

Mouse Anti-Glycoprotein 210 Antibody AGPA ELISA Kit

Sign In for Pricing
View Details
Raffinose Rf
DD029-1VL 1 unit

Raffinose Rf

Sign In for Pricing
View Details
PROX1 Antibody
MBS9608758-01 0.1 mL

PROX1 Antibody

Sign In for Pricing
View Details