Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S58 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
40128061 1.0 µg DNA

RN5S58 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
C14orf74 ORF Vector (Human) (pORF)
ORF016420 1.0 µg DNA

C14orf74 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RRP44A Polyclonal Antibody
MBS7186272 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RRP44A Polyclonal Antibody

Sign In for Pricing
View Details
ABHD4 Protein Vector (Rat) (pPB-C-His)
PV251570 500 ng

ABHD4 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
SP3 Antibody (Biotin)
KB-3710-01 50 μL

SP3 Antibody (Biotin)

Sign In for Pricing
View Details
SP3 Antibody (Biotin)
KB-3710-02 100 µL

SP3 Antibody (Biotin)

Sign In for Pricing
View Details