Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pleiotrophin (PTN) Peptide
abx616020 100 µg

Pleiotrophin (PTN) Peptide

Sign In for Pricing
View Details
Fibroblast Growth Factor Receptor 4 (FGFR4) Antibody
abx172425 1 mL

Fibroblast Growth Factor Receptor 4 (FGFR4) Antibody

Sign In for Pricing
View Details
CXorf19-set siRNA/shRNA/RNAi Lentivector (Human)
56061091 4x 500 ng

CXorf19-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
STXBP2 3'UTR GFP Stable Cell Line
TU074881 1.0 mL

STXBP2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Verapamil 50mg
A12679-50 50 mg

Verapamil 50mg

Sign In for Pricing
View Details
UBAC2 sgRNA CRISPR Lentivector (Human) (Target 2)
K2568903 1.0 µg DNA

UBAC2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details