Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus cereus Membrane protein insertase YidC 2 (yidC2), partial
MBS7091301 Inquire

Recombinant Bacillus cereus Membrane protein insertase YidC 2 (yidC2), partial

Sign In for Pricing
View Details
FOLR1 (Folate Receptor alpha, FR-alpha, Adult Folate-binding Protein, FBP, Folate Receptor 1, Folate Receptor, Adult, KB cells FBP, Ovarian Tumor-associated Antigen MOv18, FOLR)
140347 200 µL

FOLR1 (Folate Receptor alpha, FR-alpha, Adult Folate-binding Protein, FBP, Folate Receptor 1, Folate Receptor, Adult, KB cells FBP, Ovarian Tumor-associated Antigen MOv18, FOLR)

Sign In for Pricing
View Details
H1FNT Recombinant Protein (Human)
RP039691 100 µg

H1FNT Recombinant Protein (Human)

Sign In for Pricing
View Details
Luteoloside 10mg
A12085-10 10 mg

Luteoloside 10mg

Sign In for Pricing
View Details
7-Deaza-2'-deoxyguanosine 5'-triphosphate
MBS5824897 Inquire

7-Deaza-2'-deoxyguanosine 5'-triphosphate

Sign In for Pricing
View Details
Agrp sgRNA CRISPR Lentivector (Rat) (Target 1)
K7542102 1.0 µg DNA

Agrp sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details