Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Syndecan-1/CD138 Antibody (DL-101) [Janelia Fluor 525]
NBP1-43351JF525 0.1 mL

Mouse Monoclonal Syndecan-1/CD138 Antibody (DL-101) [Janelia Fluor 525]

Sign In for Pricing
View Details
9930111J21Rik1 Protein Vector (Mouse) (pPB-C-His)
PV150554 500 ng

9930111J21Rik1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Meaf6 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6112003 1.0 µg DNA

Meaf6 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PECMV-Wnt4-m-FLAG
BZ15826 1 Vial

PECMV-Wnt4-m-FLAG

Sign In for Pricing
View Details
OR5M9 (Olfactory Receptor 5M9, Olfactory Receptor OR11-190, OR5M9) (APC)
MBS6457945-01 0.2 mL

OR5M9 (Olfactory Receptor 5M9, Olfactory Receptor OR11-190, OR5M9) (APC)

Sign In for Pricing
View Details
OR5M9 (Olfactory Receptor 5M9, Olfactory Receptor OR11-190, OR5M9) (APC)
MBS6457945-02 5x 0.2 mL

OR5M9 (Olfactory Receptor 5M9, Olfactory Receptor OR11-190, OR5M9) (APC)

Sign In for Pricing
View Details