Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OBFC1 sgRNA CRISPR Lentivector (Human) (Target 3)
K1473904 1.0 µg DNA

OBFC1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse CC-chemokine receptor 5 (CCR5) ELISA Kit
YP-W23918-01 48 Tests

Mouse CC-chemokine receptor 5 (CCR5) ELISA Kit

Sign In for Pricing
View Details
Mouse CC-chemokine receptor 5 (CCR5) ELISA Kit
YP-W23918-02 96 Tests

Mouse CC-chemokine receptor 5 (CCR5) ELISA Kit

Sign In for Pricing
View Details
Mpv17l (NM_033564) Mouse Tagged ORF Clone
MR201894 10 µg

Mpv17l (NM_033564) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ATP6AP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV705310 1.0 µg DNA

ATP6AP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human Rho Guanine Nucleotide Exchange Factor 2 (ARHGEF2) ELISA Kit
MBS1602814-01 48 Well

Human Rho Guanine Nucleotide Exchange Factor 2 (ARHGEF2) ELISA Kit

Sign In for Pricing
View Details