Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Allergin-1, Human (HEK293, His)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, His) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Allergin-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/allergin-1-protein-human-hek293-his.html

Purity

96.00

Smiles

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

Molecular Formula

284021 (Gene_ID) Q7Z6M3-1 (R20-K227) (Accession)

Molecular Weight

Approximately 40-57 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXL2 Protein Vector (Mouse) (pPB-C-His)
PV180122 500 ng

FOXL2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GC Column, H2-1, 15m*0.32mm*0.5um, 1pc/pk
14041006 1 PC

GC Column, H2-1, 15m*0.32mm*0.5um, 1pc/pk

Sign In for Pricing
View Details
AQ-13 dihydrochloride
MF-0004448-01 1 mg

AQ-13 dihydrochloride

Sign In for Pricing
View Details
AQ-13 dihydrochloride
MF-0004448-02 5 mg

AQ-13 dihydrochloride

Sign In for Pricing
View Details
AQ-13 dihydrochloride
MF-0004448-03 1 mL - 10 mM (in DMSO)

AQ-13 dihydrochloride

Sign In for Pricing
View Details
AQ-13 dihydrochloride
MF-0004448-04 10 mg

AQ-13 dihydrochloride

Sign In for Pricing
View Details