Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRTN3, Human (HEK293, His, solution)

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (HEK293, His, solution) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRTN3 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prtn3-protein-human-hek-293-his.html

Purity

98.0

Smiles

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

Molecular Formula

5657 (Gene_ID) P24158 (A26-R249) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Apg10 (ATG10) activation kit by CRISPRa
GA113253 1 Kit

Human Apg10 (ATG10) activation kit by CRISPRa

Sign In for Pricing
View Details
N-Nitroso-(1S,2R)-ephedrine
TRC-N434850-250MG 250 mg

N-Nitroso-(1S,2R)-ephedrine

Sign In for Pricing
View Details
CNRIP1 (Center) Rabbit Polyclonal Antibody
AP50991PU-N 400 µL

CNRIP1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), 0.2mg/mL
BNUB2183-500 1x 500 µL

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), 0.2mg/mL

Sign In for Pricing
View Details
Apolipoprotein M (APOM) Mouse Monoclonal Antibody [Clone ID: 10C3G5]
AM06158PU-N 100 µL

Apolipoprotein M (APOM) Mouse Monoclonal Antibody [Clone ID: 10C3G5]

Sign In for Pricing
View Details
TRIP12 Rabbit Polyclonal Antibody
TA382844 100 µL

TRIP12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details