Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRTN3, Human (HEK293, His, solution)

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (HEK293, His, solution) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRTN3 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prtn3-protein-human-hek-293-his.html

Purity

98.0

Smiles

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

Molecular Formula

5657 (Gene_ID) P24158 (A26-R249) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Beta-Catenin/CTNNB1 Protein (His & GST Tag)
PKSH031171 100 µg

Recombinant Human Beta-Catenin/CTNNB1 Protein (His & GST Tag)

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) Mouse Monoclonal Antibody [Clone ID: 9F2]
AM26399PU-L 500 µg

alpha 1 Antitrypsin (SERPINA1) Mouse Monoclonal Antibody [Clone ID: 9F2]

Sign In for Pricing
View Details
Vimentin Antibody
F48161-0.4ML 0.4 mL

Vimentin Antibody

Sign In for Pricing
View Details
NOLA1 (GAR1) (NM_032993) Human Recombinant Protein
TP312074 20 µg

NOLA1 (GAR1) (NM_032993) Human Recombinant Protein

Sign In for Pricing
View Details
Buccutite™ Rapid PE-Cy5 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*
1322-AAT 2 Labelings

Buccutite™ Rapid PE-Cy5 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*

Sign In for Pricing
View Details
p53 (TP53) Rabbit Polyclonal Antibody
AP08046PU-S 50 µL

p53 (TP53) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details