Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRTN3, Human (HEK293, His, solution)

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (HEK293, His, solution) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRTN3 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prtn3-protein-human-hek-293-his.html

Purity

98.0

Smiles

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

Molecular Formula

5657 (Gene_ID) P24158 (A26-R249) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Arabinitol
TRC-A735600-50G 50 g

D-Arabinitol

Sign In for Pricing
View Details
OR2T8 (C-term) Rabbit Polyclonal Antibody
AP53042PU-N 400 µL

OR2T8 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2858R), CF647 conjugate, 0.1mg/mL
BNC472858-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2858R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (N439K) (His Tag)
PKSV030412-01 50 µg

Recombinant SARS-CoV-2 Spike RBD (N439K) (His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (N439K) (His Tag)
PKSV030412-02 500 µg

Recombinant SARS-CoV-2 Spike RBD (N439K) (His Tag)

Sign In for Pricing
View Details
PPP2R1B (NM_181699) Human Over-expression Lysate
LC403624 20 µg

PPP2R1B (NM_181699) Human Over-expression Lysate

Sign In for Pricing
View Details