Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRTN3, Human (HEK293, His, solution)

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation. It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration. PRTN3 Protein, Human (HEK293, His, solution) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PRTN3 Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prtn3-protein-human-hek-293-his.html

Purity

98.0

Smiles

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

Molecular Formula

5657 (Gene_ID) P24158 (A26-R249) (Accession)

Molecular Weight

Approximately 34.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR29 (NM_001164257) Human Over-expression Lysate
LC431150 20 µg

PRR29 (NM_001164257) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Leptin, Tag Free
HA210898-01 20 µg

Mouse Leptin, Tag Free

Sign In for Pricing
View Details
Mouse Leptin, Tag Free
HA210898-02 50 µg

Mouse Leptin, Tag Free

Sign In for Pricing
View Details
Mouse Leptin, Tag Free
HA210898-03 100 µg

Mouse Leptin, Tag Free

Sign In for Pricing
View Details
(R)-1-Hydroxy-1-phenylpropanone
TRC-H949610-10MG 10 mg

(R)-1-Hydroxy-1-phenylpropanone

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS506572 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details