Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 18 Binding Protein (IL18BP) Magnetic Fluorescence Assay Kit
MBS2160917-01 96 Tests

Interleukin 18 Binding Protein (IL18BP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Interleukin 18 Binding Protein (IL18BP) Magnetic Fluorescence Assay Kit
MBS2160917-02 5x 96 Tests

Interleukin 18 Binding Protein (IL18BP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Interleukin 18 Binding Protein (IL18BP) Magnetic Fluorescence Assay Kit
MBS2160917-03 10x 96 Tests

Interleukin 18 Binding Protein (IL18BP) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Recombinant Human IL-17B
1248-IB-025 25 µg

Recombinant Human IL-17B

Sign In for Pricing
View Details
SMYD2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6193R-BF750 100 µL

SMYD2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Gm1123 Mouse siRNA Oligo Duplex (Locus ID 382097)
SR413073 1 Kit

Gm1123 Mouse siRNA Oligo Duplex (Locus ID 382097)

Sign In for Pricing
View Details