Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CES1 protein, Human, Recombinant (His)
E51P91600 20 µg

CES1 protein, Human, Recombinant (His)

Sign In for Pricing
View Details
Mouse Keratinocyte-associated transmembrane protein 2 (KCT2) ELISA Kit
abx529781 96 Tests

Mouse Keratinocyte-associated transmembrane protein 2 (KCT2) ELISA Kit

Sign In for Pricing
View Details
Emerin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6660R-BF350 100 µL

Emerin Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Progesterone Receptor (PGR) (NM_001202474) Human Untagged Clone
SC331457 10 µg

Progesterone Receptor (PGR) (NM_001202474) Human Untagged Clone

Sign In for Pricing
View Details
Human Betacellulin Protein, premium grade
BEN-H5116-20ug 20 µg

Human Betacellulin Protein, premium grade

Sign In for Pricing
View Details
Recombinant Human Early growth response protein 1, His, Yeast-50ug
QP9116-ye-50ug 50ug

Recombinant Human Early growth response protein 1, His, Yeast-50ug

Sign In for Pricing
View Details