Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-6 (Interleukin BSF 2, B Cell Differentiation Factor, B Cell Stimulatory Factor 2, B-Cell Stimulatory Factor 2, BSF 2, BSF-2, BSF2, CDF, CTL Differentiation Factor, Cytotoxic T Cell Differentiation Factor, Hepatocyte stimulating Factor, HGF, HPGF, HSF, Hybridoma Growth Factor, Hybridoma Growth Factor Interferon beta-2, Hybridoma plasmacytoma Growth Factor, IFN-beta-2, IFNB2, IL 6, IL-6, IL6, IL6 Protein, IL6, Interferon beta 2, Interferon beta-2, Interleukin 6 (interf) discontinued
223575-01 50 µL

IL-6 (Interleukin BSF 2, B Cell Differentiation Factor, B Cell Stimulatory Factor 2, B-Cell Stimulatory Factor 2, BSF 2, BSF-2, BSF2, CDF, CTL Differentiation Factor, Cytotoxic T Cell Differentiation Factor, Hepatocyte stimulating Factor, HGF, HPGF, HSF, Hybridoma Growth Factor, Hybridoma Growth Factor Interferon beta-2, Hybridoma plasmacytoma Growth Factor, IFN-beta-2, IFNB2, IL 6, IL-6, IL6, IL6 Protein, IL6, Interferon beta 2, Interferon beta-2, Interleukin 6 (interf) discontinued

Sign In for Pricing
View Details
IL-6 (Interleukin BSF 2, B Cell Differentiation Factor, B Cell Stimulatory Factor 2, B-Cell Stimulatory Factor 2, BSF 2, BSF-2, BSF2, CDF, CTL Differentiation Factor, Cytotoxic T Cell Differentiation Factor, Hepatocyte stimulating Factor, HGF, HPGF, HSF, Hybridoma Growth Factor, Hybridoma Growth Factor Interferon beta-2, Hybridoma plasmacytoma Growth Factor, IFN-beta-2, IFNB2, IL 6, IL-6, IL6, IL6 Protein, IL6, Interferon beta 2, Interferon beta-2, Interleukin 6 (interf) discontinued
223575-02 100 µL

IL-6 (Interleukin BSF 2, B Cell Differentiation Factor, B Cell Stimulatory Factor 2, B-Cell Stimulatory Factor 2, BSF 2, BSF-2, BSF2, CDF, CTL Differentiation Factor, Cytotoxic T Cell Differentiation Factor, Hepatocyte stimulating Factor, HGF, HPGF, HSF, Hybridoma Growth Factor, Hybridoma Growth Factor Interferon beta-2, Hybridoma plasmacytoma Growth Factor, IFN-beta-2, IFNB2, IL 6, IL-6, IL6, IL6 Protein, IL6, Interferon beta 2, Interferon beta-2, Interleukin 6 (interf) discontinued

Sign In for Pricing
View Details
Human SLC5A5 knockout cell line
ABC-KH14161 1 Vial

Human SLC5A5 knockout cell line

Sign In for Pricing
View Details
Chmp3 (NM_025783) Mouse Untagged Clone
MC204657 10 µg

Chmp3 (NM_025783) Mouse Untagged Clone

Sign In for Pricing
View Details
Rabbit Polyclonal FAM180B Antibody
NBP1-93542 0.1 mL

Rabbit Polyclonal FAM180B Antibody

Sign In for Pricing
View Details
NME2 Antibody
MBS7130672-01 0.1 mL

NME2 Antibody

Sign In for Pricing
View Details