Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory Receptor 2B8
326713-01 50 µg

Olfactory Receptor 2B8

Sign In for Pricing
View Details
Olfactory Receptor 2B8
326713-02 100 µg

Olfactory Receptor 2B8

Sign In for Pricing
View Details
RICH2, CT (ARHGAP44, KIAA0672, RICH2, Rho GTPase-activating protein 44, NPC-A-10, Rho-type GTPase-activating protein RICH2, RhoGAP interacting with CIP4 homologs protein 2) (MaxLight 490)
MBS6342110-01 0.1 mL

RICH2, CT (ARHGAP44, KIAA0672, RICH2, Rho GTPase-activating protein 44, NPC-A-10, Rho-type GTPase-activating protein RICH2, RhoGAP interacting with CIP4 homologs protein 2) (MaxLight 490)

Sign In for Pricing
View Details
RICH2, CT (ARHGAP44, KIAA0672, RICH2, Rho GTPase-activating protein 44, NPC-A-10, Rho-type GTPase-activating protein RICH2, RhoGAP interacting with CIP4 homologs protein 2) (MaxLight 490)
MBS6342110-02 5x 0.1 mL

RICH2, CT (ARHGAP44, KIAA0672, RICH2, Rho GTPase-activating protein 44, NPC-A-10, Rho-type GTPase-activating protein RICH2, RhoGAP interacting with CIP4 homologs protein 2) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Rat Cd44 Protein, His (Fc)-Avi-tagged
Cd44-3R 50 µg

Recombinant Rat Cd44 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rat SHOC2 shRNA Plasmid
abx989562-01 150 µg

Rat SHOC2 shRNA Plasmid

Sign In for Pricing
View Details