Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGR5 Antibody
ABD2816 100 µg

LGR5 Antibody

Sign In for Pricing
View Details
MTOR inhibitor-1 50mg
A20029-50 50 mg

MTOR inhibitor-1 50mg

Sign In for Pricing
View Details
AP2B1 Antibody
A12788-100UL 100 µL

AP2B1 Antibody

Sign In for Pricing
View Details
RPS26P47 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2052907 1.0 µg DNA

RPS26P47 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Cavy Prefoldin Subunit 3 (PFDN3) ELISA Kit
MBS9904522 Inquire

Cavy Prefoldin Subunit 3 (PFDN3) ELISA Kit

Sign In for Pricing
View Details
MIR326 Rat qPCR Primer Pair (MI0000599)
RP300188 200 Reactions

MIR326 Rat qPCR Primer Pair (MI0000599)

Sign In for Pricing
View Details