Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPRYD4 Knockout A549 cell line
GTR15420386 1 Vial

Human SPRYD4 Knockout A549 cell line

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase RNF152 (RNF152) Chicken ELISA Kit
D0752 96 Tests

E3 ubiquitin-protein ligase RNF152 (RNF152) Chicken ELISA Kit

Sign In for Pricing
View Details
Tcf12 (NM_013176) Rat Tagged ORF Clone
RR214204 10 µg

Tcf12 (NM_013176) Rat Tagged ORF Clone

Sign In for Pricing
View Details
MARC-145 [Marc145] Cell Complete Medium
CM-0566 4x 125 mL

MARC-145 [Marc145] Cell Complete Medium

Sign In for Pricing
View Details
NKAIN3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV645923 1.0 µg DNA

NKAIN3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Porcine Interleukin 2 Receptor Alpha ELISA Kit
MBS7274560-01 48 Well

Porcine Interleukin 2 Receptor Alpha ELISA Kit

Sign In for Pricing
View Details