Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Multimerin 1 (MMRN1) ELISA Kit
RDR-MMRN1-Hu-48Tests 48 Tests

Human Multimerin 1 (MMRN1) ELISA Kit

Sign In for Pricing
View Details
Grik3 (NM_181373) Rat Tagged ORF Clone
RR200120 10 µg

Grik3 (NM_181373) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Troponin T, Cardiac (cTnT) (MaxLight 750)
MBS6265328-01 0.1 mL

Troponin T, Cardiac (cTnT) (MaxLight 750)

Sign In for Pricing
View Details
Troponin T, Cardiac (cTnT) (MaxLight 750)
MBS6265328-02 5x 0.1 mL

Troponin T, Cardiac (cTnT) (MaxLight 750)

Sign In for Pricing
View Details
Lentiviral human SETD5 shRNA (UAS) - Lentiviral human SETD5 shRNA (UAS, iRFP) (25)
GTR15150122 1 Vial

Lentiviral human SETD5 shRNA (UAS) - Lentiviral human SETD5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
LHX9 siRNA (Mouse)
CRM2346-01 15 nmol

LHX9 siRNA (Mouse)

Sign In for Pricing
View Details