Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chlamydophila Trachomatis recR Protein (aa 1-200) (strain 434/Bu / ATCC VR-902B)
VAng-Lsx7017-50gEcoli 50 µg (E. coli)

Recombinant Chlamydophila Trachomatis recR Protein (aa 1-200) (strain 434/Bu / ATCC VR-902B)

Sign In for Pricing
View Details
ELISA kit for Mouse Multiple C2 and transmembrane domain-containing protein 2 (MCTP2)
KTE71093-01 48 Tests

ELISA kit for Mouse Multiple C2 and transmembrane domain-containing protein 2 (MCTP2)

Sign In for Pricing
View Details
ELISA kit for Mouse Multiple C2 and transmembrane domain-containing protein 2 (MCTP2)
KTE71093-02 96 Tests

ELISA kit for Mouse Multiple C2 and transmembrane domain-containing protein 2 (MCTP2)

Sign In for Pricing
View Details
ELISA kit for Mouse Multiple C2 and transmembrane domain-containing protein 2 (MCTP2)
KTE71093-03 5x 96 Well

ELISA kit for Mouse Multiple C2 and transmembrane domain-containing protein 2 (MCTP2)

Sign In for Pricing
View Details
Rat Anti-Mouse CD24-PE
1815-09L 0.2 mg

Rat Anti-Mouse CD24-PE

Sign In for Pricing
View Details
Purified anti-human CD62E Recombinant
GT15945 100 µg

Purified anti-human CD62E Recombinant

Sign In for Pricing
View Details