Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPR3 cDNA Clone
MBS1275577-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

FPR3 cDNA Clone

Sign In for Pricing
View Details
FPR3 cDNA Clone
MBS1275577-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

FPR3 cDNA Clone

Sign In for Pricing
View Details
Mouse Zdhhc22 (NM_001080943) AAV Particle
MR220385A1V 250 µL

Mouse Zdhhc22 (NM_001080943) AAV Particle

Sign In for Pricing
View Details
Quartz Powder Pure
205235-01 250 g

Quartz Powder Pure

Sign In for Pricing
View Details
Quartz Powder Pure
205235-02 1 kg

Quartz Powder Pure

Sign In for Pricing
View Details
PRKACB Knockout Cell Lysate
ABC-KC1574 100 µg

PRKACB Knockout Cell Lysate

Sign In for Pricing
View Details