Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J2, Human (Cell-Free, His)

ATP5J2 protein is a component of mitochondrial membrane ATP synthase (complex V), which uses the proton gradient established by the respiratory chain electron transport complex to help ADP synthesize ATP. ATP5J2 is located in the F (0) domain as a small subunit and cooperates with subunit a in the membrane. ATP5J2 Protein, Human (Cell-Free, His) is the recombinant human-derived ATP5J2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

ATP5J2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/atp5j2-protein-human-cf-his.html

Smiles

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Molecular Formula

9551 (Gene_ID) P56134 (M1-H94) (Accession)

Molecular Weight

12.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OXR1 (NM_181354) AAV Particle
RC207662A1V 250 µL

Human OXR1 (NM_181354) AAV Particle

Sign In for Pricing
View Details
RGD1559970 3'UTR Luciferase Stable Cell Line
TU218122 1.0 mL

RGD1559970 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal HLA-DR Antibody (L243) - Azide and BSA Free
NBP2-80773 0.1 mL

Mouse Monoclonal HLA-DR Antibody (L243) - Azide and BSA Free

Sign In for Pricing
View Details
Rat Growth and differentiation factor associated serum protein-1 (GASP-1) ELISA Kit
MBS1600448-01 48 Well

Rat Growth and differentiation factor associated serum protein-1 (GASP-1) ELISA Kit

Sign In for Pricing
View Details
Rat Growth and differentiation factor associated serum protein-1 (GASP-1) ELISA Kit
MBS1600448-02 96 Well

Rat Growth and differentiation factor associated serum protein-1 (GASP-1) ELISA Kit

Sign In for Pricing
View Details
Rat Growth and differentiation factor associated serum protein-1 (GASP-1) ELISA Kit
MBS1600448-03 5x 96 Well

Rat Growth and differentiation factor associated serum protein-1 (GASP-1) ELISA Kit

Sign In for Pricing
View Details