Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neurotrimin, Human (HEK293, His)

Neurotrimin Protein, a neural cell adhesion molecule, plays a crucial role in facilitating neural connections through its adhesive properties. As a member of the cell adhesion molecule family, Neurotrimin influences various aspects of neural function, including cell adhesion, communication, and potential contributions to neuronal development and synaptic plasticity, underscoring its significance as a molecular mediator within the nervous system. Neurotrimin Protein, Human (HEK293, His) is the recombinant human-derived Neurotrimin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Neurotrimin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neurotrimin-protein-human-hek-293-his.html

Purity

98.0

Smiles

GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGETVL

Molecular Formula

50863 (Gene_ID) Q9P121-3 (G34-L316) (Accession)

Molecular Weight

51-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IL23 (IL23A) (NM_016584) Human Tagged Lenti ORF Clone
RC209680L3 10 µg

IL23 (IL23A) (NM_016584) Human Tagged Lenti ORF Clone

Ask
View Details
Human PRR22 knockout cell line
ABC-KH12231 1 Vial

Human PRR22 knockout cell line

Ask
View Details
Recombinant Agrobacterium tumefaciens Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1378783-01 0.02 mg (E-Coli)

Recombinant Agrobacterium tumefaciens Arginine biosynthesis bifunctional protein ArgJ (argJ)

Ask
View Details
Recombinant Agrobacterium tumefaciens Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1378783-02 0.1 mg (E-Coli)

Recombinant Agrobacterium tumefaciens Arginine biosynthesis bifunctional protein ArgJ (argJ)

Ask
View Details
Recombinant Agrobacterium tumefaciens Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1378783-03 0.02 mg (Yeast)

Recombinant Agrobacterium tumefaciens Arginine biosynthesis bifunctional protein ArgJ (argJ)

Ask
View Details
Recombinant Agrobacterium tumefaciens Arginine biosynthesis bifunctional protein ArgJ (argJ)
MBS1378783-04 0.1 mg (Yeast)

Recombinant Agrobacterium tumefaciens Arginine biosynthesis bifunctional protein ArgJ (argJ)

Ask
View Details