IL-36 gamma/IL-1F9, Mouse

GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

[1]Bassoy EY, et al. Regulation and function of interleukin-36 cytokines. Immunol Rev. 2018 Jan;281 (1) :169-178.|[2]Zhou L, et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.|[3]Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25 (6) :458-65.|[4]Melissa A. Kovach, et al. IL-36γ is a Potent Inducer of Type I and IL-17 Cytokine Induction During Lung Infection. American Journal of Respiratory and Critical Care Medicine, 2015, 191: 1.|[5]Wein AN, et al. IL-36γ Protects against Severe Influenza Infection by Promoting Lung Alveolar Macrophage Survival and Limiting Viral Replication. J Immunol. 2018 Jul 15;201 (2) :573-582.|[6]Kovach MA, et al. IL-36γ is a crucial proximal component of protective type-1-mediated lung mucosal immunity in Gram-positive and -negative bacterial pneumonia. Mucosal Immunol. 2017 Sep;10 (5) :1320-1334.|[7]Aoyagi T, et al. Interleukin-36γ and IL-36 receptor signaling mediate impaired host immunity and lung injury in cytotoxic Pseudomonas aeruginosa pulmonary infection: Role of prostaglandin E2. PLoS Pathog. 2017 Nov 22;13 (11) :e1006737.|[8]Gardner JK, Herbst-Kralovetz MM. IL-36γ induces a transient HSV-2 resistant environment that protects against genital disease and pathogenesis. Cytokine. 2018 Nov;111:63-71.