Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Human (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human (His) is produced in E.coil with six N-Terminal His-tags. It consists of 134 amino acids (S78-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-human-his.html

Purity

95.0

Smiles

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

2668 (Gene_ID) P39905-1 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SNORD114-6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
44727111 3x 1.0 µg

SNORD114-6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Ask
View Details
Bcl-6, phosphorylated (Ser333) discontinued
533530-01 30ul

Bcl-6, phosphorylated (Ser333) discontinued

Ask
View Details
Bcl-6, phosphorylated (Ser333) discontinued
533530-02 100 µL

Bcl-6, phosphorylated (Ser333) discontinued

Ask
View Details
CD6 (Cluster of Differentiation 6) BioAssayTM ELISA Kit (Rat) discontinued
382281 96 Tests

CD6 (Cluster of Differentiation 6) BioAssayTM ELISA Kit (Rat) discontinued

Ask
View Details
Docking protein 3 (DOK3) Mouse ELISA Kit
C9851 96 Tests

Docking protein 3 (DOK3) Mouse ELISA Kit

Ask
View Details
Human PPP1R9A/Neurabin-1 ELISA Kit
MBS2907494-01 48 Well

Human PPP1R9A/Neurabin-1 ELISA Kit

Ask
View Details