Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Human (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human (His) is produced in E.coil with six N-Terminal His-tags. It consists of 134 amino acids (S78-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-human-his.html

Purity

95.0

Smiles

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

2668 (Gene_ID) P39905-1 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human SPI1 Pre-designed siRNA Set A
SI015649A 1 Each

Human SPI1 Pre-designed siRNA Set A

Ask
View Details
Pcbd1 (NM_025273) Mouse Tagged ORF Clone Lentiviral Particle
MR200344L3V 200 µL

Pcbd1 (NM_025273) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse Agl activation kit by CRISPRa
GA210768 1 Kit

Mouse Agl activation kit by CRISPRa

Ask
View Details
Sheep Chemokine C-Motif Ligand 2 ELISA Kit
MBS097976-01 48 Well

Sheep Chemokine C-Motif Ligand 2 ELISA Kit

Ask
View Details
Sheep Chemokine C-Motif Ligand 2 ELISA Kit
MBS097976-02 96 Well

Sheep Chemokine C-Motif Ligand 2 ELISA Kit

Ask
View Details
Sheep Chemokine C-Motif Ligand 2 ELISA Kit
MBS097976-03 5x 96 Well

Sheep Chemokine C-Motif Ligand 2 ELISA Kit

Ask
View Details