Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Human (His)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Human (His) is produced in E.coil with six N-Terminal His-tags. It consists of 134 amino acids (S78-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-human-his.html

Purity

95.0

Smiles

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

2668 (Gene_ID) P39905-1 (S78-I211) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[2]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[3]Michael Meir, et al. Intestinal Epithelial Barrier Maturation by Enteric Glial Cells Is GDNF-Dependent. Int J Mol Sci. 2021 Feb 14;22 (4) :1887.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ACCN5 (ASIC5) Human qPCR Template Standard (NM_017419)
HK210511 1 Kit

ACCN5 (ASIC5) Human qPCR Template Standard (NM_017419)

Ask
View Details
Inward rectifier potassium channel 13 (KCNJ13) Guinea Pig ELISA Kit
E4345 96 Tests

Inward rectifier potassium channel 13 (KCNJ13) Guinea Pig ELISA Kit

Ask
View Details
CRIP1 (C-Term) Rabbit pAb
MBS8558157-01 0.1 mL

CRIP1 (C-Term) Rabbit pAb

Ask
View Details
CRIP1 (C-Term) Rabbit pAb
MBS8558157-02 0.1 mL (AF405L)

CRIP1 (C-Term) Rabbit pAb

Ask
View Details
CRIP1 (C-Term) Rabbit pAb
MBS8558157-03 0.1 mL (AF405S)

CRIP1 (C-Term) Rabbit pAb

Ask
View Details
CRIP1 (C-Term) Rabbit pAb
MBS8558157-04 0.1 mL (AF610)

CRIP1 (C-Term) Rabbit pAb

Ask
View Details