Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 5 (PMT5), partial

Product Specifications

Product Name Alternative

PMT5; YDL093W; D2399; Dolichyl-phosphate-mannose--protein mannosyltransferase 5; EC 2.4.1.109

Abbreviation

Recombinant Saccharomyces cerevisiae PMT5 protein, partial

Gene Name

PMT5

UniProt

P52867

Expression Region

286-583aa

Organism

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Target Sequence

SVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSAVSLNHVGTAGGYLHSHLHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHPNENVTSFQNLTDGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAIETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAYFAREDLTSWYIEENENEISLPNPEKVSYKKMSFWQKFVAIHKFMFYLNNYMDTSHAYSSEPKTWPLMLRGIDFWNENGREVYFLGNA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Protein O-mannosyltransferase involved in O-glycosylation which is essential for cell wall rigidity. Forms a heterodimeric complex with PMT3 and more rarely with PMT2 to transfer mannose from Dol-P-mannose to Ser or Thr residues on proteins.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.6 kDa

References & Citations

"The sequence of a 16,691 bp segment of Saccharomyces cerevisiae chromosome IV identifies the DUN1, PMT1, PMT5, SRP14 and DPR1 genes, and five new open reading frames." Boskovic J., Soler-Mira A., Garcia-Cantalejo J.M., Ballesta J.P.G., Jimenez A., Remacha M.A. Yeast 12:1377-1384 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)
MBS1147970-01 0.02 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)
MBS1147970-02 0.02 mg (Yeast)

Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)
MBS1147970-03 0.1 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)
MBS1147970-04 0.1 mg (Yeast)

Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)
MBS1147970-05 0.02 mg (Baculovirus)

Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)
MBS1147970-06 0.02 mg (Mammalian-Cell)

Recombinant Neisseria meningitidis serogroup C Phosphoglycerate kinase (pgk)

Sign In for Pricing
View Details