Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 6 protein (FAS), partial (Active)

Product Specifications

Product Name Alternative

Apo-1 antigen, FASLG receptor, CD antigen CD95

Abbreviation

Recombinant Human FAS protein, partial (Active)

Gene Name

FAS

UniProt

P25445

Expression Region

17-173aa

Organism

Homo sapiens (Human)

Target Sequence

RLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Cancer

Relevance

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro) . {ECO:0000269|PubMed:19118384, ECO:0000269|PubMed:7533181}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cytotoxicity of Jurkat cells is between 10-15 µg/ml in the presence of 2 ng/ml of rHuFas Ligand.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro) .

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gcnt1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3846502 1.0 µg DNA

Gcnt1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
NCOR1 (Nuclear Receptor Corepressor 1, N-CoR, N-CoR1, KIAA1047) (FITC)
MBS6269850-01 0.1 mL

NCOR1 (Nuclear Receptor Corepressor 1, N-CoR, N-CoR1, KIAA1047) (FITC)

Sign In for Pricing
View Details
NCOR1 (Nuclear Receptor Corepressor 1, N-CoR, N-CoR1, KIAA1047) (FITC)
MBS6269850-02 5x 0.1 mL

NCOR1 (Nuclear Receptor Corepressor 1, N-CoR, N-CoR1, KIAA1047) (FITC)

Sign In for Pricing
View Details
Human PLCB1 Protein Lysate
MBS8417322-01 0.02 mg

Human PLCB1 Protein Lysate

Sign In for Pricing
View Details
Human PLCB1 Protein Lysate
MBS8417322-02 5x 0.02 mg

Human PLCB1 Protein Lysate

Sign In for Pricing
View Details
RMP (D-2) AC
sc-376011 AC 500 µg/mL - 25% ag

RMP (D-2) AC

Sign In for Pricing
View Details