Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SUN domain-containing protein 1 (SUN1), partial

Product Specifications

Product Name Alternative

Protein unc-84 homolog A; Sad1/unc-84 protein-like 1

Abbreviation

Recombinant Human SUN1 protein, partial

Gene Name

SUN1

UniProt

O94901

Expression Region

1-220aa

Organism

Homo sapiens (Human)

Target Sequence

MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAAPGPVSRVYSRDRNQKC

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Involved in telomere attachment to nuclear envelope in the prophase of meiosis implicating a SUN1/2:KASH5 LINC complex in which SUN1 and SUN2 seem to act at least partial redundantly. Required for gametogenesis and involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis. Helps to define the distribution of nuclear pore complexes (NPCs) . Required for efficient localization of SYNE4 in the nuclear envelope. May be involved in nuclear remodeling during sperm head formation in spermatogenesis. May play a role in DNA repair by suppressing non-homologous end joining repair to facilitate the repair of DNA cross-links.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)
MBS1064901-01 0.02 mg (Yeast)

Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)

Ask
View Details
Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)
MBS1064901-02 0.1 mg (Yeast)

Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)

Ask
View Details
Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)
MBS1064901-03 1 mg (Yeast)

Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)

Ask
View Details
Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)
MBS1064901-04 5x 1 mg (Yeast)

Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)

Ask
View Details
Lentiviral mouse Syndig1 shRNA (UAS) - Lentiviral mouse Syndig1 shRNA (UAS, RFP) (25)
GTR15270947 1 Vial

Lentiviral mouse Syndig1 shRNA (UAS) - Lentiviral mouse Syndig1 shRNA (UAS, RFP) (25)

Ask
View Details
IRAK2, CT (IRAK-2, Interleukin-1 Receptor-associated Kinase-like 2, Interleukin-1 Receptor-associated Kinase 2)
303395 100 µg

IRAK2, CT (IRAK-2, Interleukin-1 Receptor-associated Kinase-like 2, Interleukin-1 Receptor-associated Kinase 2)

Ask
View Details