CD47, Human (HEK293, His)
CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.
Product Specifications
Product Name Alternative
CD47 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-his.html
Purity
95.00
Smiles
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH
Molecular Formula
961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)
Molecular Weight
30-45 kDa
References & Citations
[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
LNX1 (E3 Ubiquitin-protein Ligase LNX, Ligand of Numb-protein X 1, Numb-binding Protein 1, PDZ Domain-containing RING Finger Protein 2, LNX, PDZRN2, UNQ574/PRO1136) (MaxLight 490)
LNX1 (E3 Ubiquitin-protein Ligase LNX, Ligand of Numb-protein X 1, Numb-binding Protein 1, PDZ Domain-containing RING Finger Protein 2, LNX, PDZRN2, UNQ574/PRO1136) (MaxLight 490)