Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, His)

CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-his.html

Purity

95.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH

Molecular Formula

961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)

Molecular Weight

30-45 kDa

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane protein 147 (TMEM147) Bovine ELISA Kit
H8243 96 Tests

Transmembrane protein 147 (TMEM147) Bovine ELISA Kit

Sign In for Pricing
View Details
KDM4A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1129606 1.0 µg DNA

KDM4A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Drosha Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-61492R-PerCP-Cy5.5 100 µL

Drosha Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
TMEM150 siRNA Oligos set (Human)
46912171 3x 5 nmol

TMEM150 siRNA Oligos set (Human)

Sign In for Pricing
View Details
DIAPH1 antibody
FNab02385 100 µg

DIAPH1 antibody

Sign In for Pricing
View Details
Prokineticin 2 (PK2) Human ELISA Kit
G1706 96 Tests

Prokineticin 2 (PK2) Human ELISA Kit

Sign In for Pricing
View Details