Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, His)

CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-his.html

Purity

95.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH

Molecular Formula

961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)

Molecular Weight

30-45 kDa

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CLDN14 antibody
STJ117839 100 µl

Anti-CLDN14 antibody

Sign In for Pricing
View Details
Deoxyribonuclease (DNase) Test Agar w/Toludine Blue (Powder)
D4020-10 500 g

Deoxyribonuclease (DNase) Test Agar w/Toludine Blue (Powder)

Sign In for Pricing
View Details
Human GNB2 Pre-designed siRNA Set B
SI006376B 1 Each

Human GNB2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TP53 Monoclonal Antibody
A10060-100UG 100 µg

TP53 Monoclonal Antibody

Sign In for Pricing
View Details
Calcoco1 (NM_139190) Rat Tagged ORF Clone Lentiviral Particle
RR215372L3V 200 µL

Calcoco1 (NM_139190) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sult2a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4315908 1.0 µg DNA

Sult2a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details