Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293, His)

CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-his.html

Purity

95.00

Smiles

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH

Molecular Formula

961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)

Molecular Weight

30-45 kDa

References & Citations

[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sema3b (NM_009153) Mouse Tagged ORF Clone Lentiviral Particle
MR222703L4V 200 µL

Sema3b (NM_009153) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
sars1 Antibody
MBS7143082 Inquire

sars1 Antibody

Sign In for Pricing
View Details
Tspyl4 AAV siRNA Pooled Vector
48634166 1.0 µg

Tspyl4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Monoclonal NEK6 Antibody (OTI5D7) [Biotin]
NBP2-72938B 0.1 mL

Mouse Monoclonal NEK6 Antibody (OTI5D7) [Biotin]

Sign In for Pricing
View Details
Mouse Lpgat1 activation kit by CRISPRa
GA213896 1 Kit

Mouse Lpgat1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS809251 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details