CD47, Human (HEK293, His)
CD47 Protein, Human (HEK293, His) is a polypeptide chain with His tag produced in HEK293 cells. CD47 is a prominent target in cancer immunotherapy.
Product Specifications
Product Name Alternative
CD47 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293-his.html
Purity
95.00
Smiles
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPHHHHHH
Molecular Formula
961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)
Molecular Weight
30-45 kDa
References & Citations
[1]Huang Y, et al. Targeting CD47: the achievements and concerns of current studies on cancer immunotherapy. J Thorac Dis. 2017 Feb;9 (2) :E168-E174.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
ITM2B, CT (ITM2B, BRI, BRI2, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, BRI2, membrane form, Mature BRI2, BRI2 intracellular domain, BRI2C, soluble form, Bri23 peptide, ABri23, C-terminal peptide, P23 peptide) (M
ITM2B, CT (ITM2B, BRI, BRI2, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, BRI2, membrane form, Mature BRI2, BRI2 intracellular domain, BRI2C, soluble form, Bri23 peptide, ABri23, C-terminal peptide, P23 peptide) (M
