Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E-selectin/CD62E, Cynomolgus (HEK293, His)

The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells. As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion. E-selectin/CD62E Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

E-selectin/CD62E Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/e-selectin-cd62e-protein-cynomolgus-hek293-his.html

Purity

98.0

Smiles

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNCTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSVPIPACKVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVPVCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGMLPTCEAPTESNTP

Molecular Formula

/ (Gene_ID) G8F370 (W22-P556) (Accession)

Molecular Weight

95-115 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)
MBS949922-01 0.02 mg (E-Coli)

Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)

Ask
View Details
Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)
MBS949922-02 0.02 mg (Yeast)

Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)

Ask
View Details
Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)
MBS949922-03 0.1 mg (E-Coli)

Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)

Ask
View Details
Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)
MBS949922-04 0.1 mg (Yeast)

Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)

Ask
View Details
Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)
MBS949922-05 0.02 mg (Baculovirus)

Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)

Ask
View Details
Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)
MBS949922-06 0.02 mg (Mammalian-Cell)

Recombinant Mouse V-type proton ATPase catalytic subunit A (Atp6v1a)

Ask
View Details