Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-B2/EFNB2, Mouse (HEK293, His)

Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Ephrin-B2/EFNB2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-b2-efnb2-protein-mouse-hek293-his.html

Smiles

MAMARSRRDSVWKYCWGLLMVLCRTAISRSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFA

Molecular Formula

13642 (Gene_ID) P52800 (R29-A232) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2M1 (NM_004068) Human Over-expression Lysate
LY418234 100 µg

AP2M1 (NM_004068) Human Over-expression Lysate

Sign In for Pricing
View Details
Cathepsin B (CTSB) Rabbit Polyclonal Antibody
AP20651PU-N 100 µg

Cathepsin B (CTSB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
iFluor™ 647 Conjugated Cytokeratin 5 Recombinant Rabbit Monoclonal Antibody [SC62-04]
HA720126F 100 µL

iFluor™ 647 Conjugated Cytokeratin 5 Recombinant Rabbit Monoclonal Antibody [SC62-04]

Sign In for Pricing
View Details
LRRC72 Human Gene Knockout Kit (CRISPR)
KN431128 1 Kit

LRRC72 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX39 (DDX39A) Human Gene Knockout Kit (CRISPR)
KN201759BN 1 Kit

DDX39 (DDX39A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Texas Red Conjugated Laburnum alpinum Lectin (Scotch Laburnum) -LAA-
T-5301-1 1 mg

Texas Red Conjugated Laburnum alpinum Lectin (Scotch Laburnum) -LAA-

Sign In for Pricing
View Details