Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPE, Mouse (HEK293, His)

RPE proteins play a key role in cellular metabolism by catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzyme activity is a key step in the non-oxidative phase of the pentose phosphate pathway and promotes the interconversion of pentose phosphates. RPE Protein, Mouse (HEK293, His) is the recombinant mouse-derived RPE protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RPE Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rpe-protein-mouse-hek293-his.html

Purity

97.00

Smiles

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR

Molecular Formula

66646 (Gene_ID) Q8VEE0 (M1-R228) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Pinus strobus Putative disease resistance protein PS10
MBS1149465-01 0.05 mg (E-Coli)

Recombinant Pinus strobus Putative disease resistance protein PS10

Ask
View Details
Recombinant Pinus strobus Putative disease resistance protein PS10
MBS1149465-02 0.2 mg (E-Coli)

Recombinant Pinus strobus Putative disease resistance protein PS10

Ask
View Details
Recombinant Pinus strobus Putative disease resistance protein PS10
MBS1149465-03 0.5 mg (E-Coli)

Recombinant Pinus strobus Putative disease resistance protein PS10

Ask
View Details
Recombinant Pinus strobus Putative disease resistance protein PS10
MBS1149465-04 0.05 mg (Yeast)

Recombinant Pinus strobus Putative disease resistance protein PS10

Ask
View Details
Recombinant Pinus strobus Putative disease resistance protein PS10
MBS1149465-05 0.05 mg (Baculovirus)

Recombinant Pinus strobus Putative disease resistance protein PS10

Ask
View Details
Recombinant Pinus strobus Putative disease resistance protein PS10
MBS1149465-06 0.2 mg (Yeast)

Recombinant Pinus strobus Putative disease resistance protein PS10

Ask
View Details