Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPE, Mouse (HEK293, His)

RPE proteins play a key role in cellular metabolism by catalyzing the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate. This enzyme activity is a key step in the non-oxidative phase of the pentose phosphate pathway and promotes the interconversion of pentose phosphates. RPE Protein, Mouse (HEK293, His) is the recombinant mouse-derived RPE protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RPE Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rpe-protein-mouse-hek293-his.html

Purity

97.00

Smiles

MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR

Molecular Formula

66646 (Gene_ID) Q8VEE0 (M1-R228) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF488A conjugate, 0.1mg/mL
BNC882290-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/2290R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF640R conjugate, 0.1mg/mL
BNC401989-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF405S conjugate, 0.1mg/mL
BNC042174-100 1x 100 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF640R conjugate, 0.1mg/mL
BNC402168-100 1x 100 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details