Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 2 (GDF2)

Product Specifications

Product Name Alternative

GDF-2; Bone morphogenetic protein 9; BMP-9

Abbreviation

Recombinant Human GDF2 protein

Gene Name

GDF2

UniProt

Q9UK05

Expression Region

300-429aa

Organism

Homo sapiens (Human)

Target Sequence

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRISPLD1 (NM_031461) Human Over-expression Lysate
LH17441V 100 µg

CRISPLD1 (NM_031461) Human Over-expression Lysate

Sign In for Pricing
View Details
Mir339 Mouse qPCR Primer Pair (MI0000621)
MP300268 200 Reactions

Mir339 Mouse qPCR Primer Pair (MI0000621)

Sign In for Pricing
View Details
TANC1 siRNA (Mouse)
MBS8222558-01 15 nmol

TANC1 siRNA (Mouse)

Sign In for Pricing
View Details
TANC1 siRNA (Mouse)
MBS8222558-02 30 nmol

TANC1 siRNA (Mouse)

Sign In for Pricing
View Details
TANC1 siRNA (Mouse)
MBS8222558-03 5x 30 nmol

TANC1 siRNA (Mouse)

Sign In for Pricing
View Details
Pyruvate Dehydrogenase α (PDHa) Human ELISA Kit
G5942 96 Tests

Pyruvate Dehydrogenase α (PDHa) Human ELISA Kit

Sign In for Pricing
View Details