Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB2 (ITGB2, CD18, MFI7, Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta) (Azide free) (HRP) discontinued
031063-HRP 200 µL

ITGB2 (ITGB2, CD18, MFI7, Integrin beta-2, Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, Complement receptor C3 subunit beta) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
S1PR1 antibody - C-terminal region
MBS3216383-01 0.1 mL

S1PR1 antibody - C-terminal region

Sign In for Pricing
View Details
S1PR1 antibody - C-terminal region
MBS3216383-02 5x 0.1 mL

S1PR1 antibody - C-terminal region

Sign In for Pricing
View Details
NR2C2 Rabbit Polyclonal Antibody
TA309259 100 µL

NR2C2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KIF1C Human shRNA Lentiviral Particle (Locus ID 10749)
TL311918V 500 µL Each

KIF1C Human shRNA Lentiviral Particle (Locus ID 10749)

Sign In for Pricing
View Details
Human GABRG3 siRNA
abx902070-01 15 nmol

Human GABRG3 siRNA

Sign In for Pricing
View Details