Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRAK 4, CT ((IL-1R-associated Kinase 4, NY-REN-64, REN64) (FITC)
MBS6483548-01 0.1 mL

IRAK 4, CT ((IL-1R-associated Kinase 4, NY-REN-64, REN64) (FITC)

Sign In for Pricing
View Details
IRAK 4, CT ((IL-1R-associated Kinase 4, NY-REN-64, REN64) (FITC)
MBS6483548-02 5x 0.1 mL

IRAK 4, CT ((IL-1R-associated Kinase 4, NY-REN-64, REN64) (FITC)

Sign In for Pricing
View Details
RPS17P10 3'UTR Luciferase Stable Cell Line
TU022048 1.0 mL

RPS17P10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DCP1A Goat Polyclonal Antibody
TA303086 100 µg

DCP1A Goat Polyclonal Antibody

Sign In for Pricing
View Details
DUSP13 Antibody, FITC conjugated
A69937-50UL 50 μL

DUSP13 Antibody, FITC conjugated

Sign In for Pricing
View Details
ER Blocking Peptide
MBS9620262-01 1 mg

ER Blocking Peptide

Sign In for Pricing
View Details