Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLBD1 Recombinant Protein Antigen
NBP2-37893PEP 0.1 mL

PLBD1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Atp6v1h (NM_133826) Mouse Tagged Lenti ORF Clone
MR207742L4 10 µg

Atp6v1h (NM_133826) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SF3B2 (Splicing Factor 3b, Subunit 2, 145kD, SAP145, SF3B145, SF3b1, SF3b150) (MaxLight 550)
MBS6219143-01 0.1 mL

SF3B2 (Splicing Factor 3b, Subunit 2, 145kD, SAP145, SF3B145, SF3b1, SF3b150) (MaxLight 550)

Sign In for Pricing
View Details
SF3B2 (Splicing Factor 3b, Subunit 2, 145kD, SAP145, SF3B145, SF3b1, SF3b150) (MaxLight 550)
MBS6219143-02 5x 0.1 mL

SF3B2 (Splicing Factor 3b, Subunit 2, 145kD, SAP145, SF3B145, SF3b1, SF3b150) (MaxLight 550)

Sign In for Pricing
View Details
Ubiquitin (FLJ25987, MGC8385, Polyubiquitin B, RPS27A, UBA52, UBA80, UBC, UBCEP1, UBCEP2, Ubiquitin B, UBB) (PE)
U1000-03C-PE 100 µL

Ubiquitin (FLJ25987, MGC8385, Polyubiquitin B, RPS27A, UBA52, UBA80, UBC, UBCEP1, UBCEP2, Ubiquitin B, UBB) (PE)

Sign In for Pricing
View Details
Lentiviral mouse Hba-a2 shRNA (UAS) - Lentiviral mouse Hba-a2 shRNA (UAS, iRFP) plasmid
GTR15207640 1 Vial

Lentiviral mouse Hba-a2 shRNA (UAS) - Lentiviral mouse Hba-a2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details