Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KHK
321653-01 50 µL

KHK

Sign In for Pricing
View Details
KHK
321653-02 100 µL

KHK

Sign In for Pricing
View Details
Ccser2 Mouse shRNA Plasmid (Locus ID 72972)
TL509445 1 Kit

Ccser2 Mouse shRNA Plasmid (Locus ID 72972)

Sign In for Pricing
View Details
Human adeno-associated virus, AAV ELISA Kit
NSL2735Hu 96 Tests

Human adeno-associated virus, AAV ELISA Kit

Sign In for Pricing
View Details
S100PBP Protein Vector (Mouse) (pPM-C-His)
PV226457 500 ng

S100PBP Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
EHMT1, ID (Histone H3-K9 Methyltransferase 5, H3-K9-HMTase 5, Euchromatic Histone-lysine N-methyltransferase 1, Eu-HMTase1, G9a-like Protein 1, GLP1, Lysine N-methyltransferase 1D, EHMT1, EUHMTASE1, KIAA1876, KMT1D, Histone-lysine N-methyltransferase, H3 Lysine-9 Specific 5) (MaxLight 750) discontinued
E8947-50F-ML750 100 µL

EHMT1, ID (Histone H3-K9 Methyltransferase 5, H3-K9-HMTase 5, Euchromatic Histone-lysine N-methyltransferase 1, Eu-HMTase1, G9a-like Protein 1, GLP1, Lysine N-methyltransferase 1D, EHMT1, EUHMTASE1, KIAA1876, KMT1D, Histone-lysine N-methyltransferase, H3 Lysine-9 Specific 5) (MaxLight 750) discontinued

Sign In for Pricing
View Details