Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPN1SW Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV660114 1.0 µg DNA

OPN1SW Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
DSTNP1 Protein Vector (Human) (pPB-N-His)
PV074182 500 ng

DSTNP1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Arginase II (Arg2) (AP)
MBS6445106-01 0.1 mL

Arginase II (Arg2) (AP)

Sign In for Pricing
View Details
Arginase II (Arg2) (AP)
MBS6445106-02 5x 0.1 mL

Arginase II (Arg2) (AP)

Sign In for Pricing
View Details
Mouse Smc1a qPCR Primer Pair
QM24318S 200 Tests

Mouse Smc1a qPCR Primer Pair

Sign In for Pricing
View Details
1q21 and 1p32 gene anomaly probe detection kit
FP-197 1 Vial 100 μL (10-20 T)

1q21 and 1p32 gene anomaly probe detection kit

Sign In for Pricing
View Details