Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-double stranded DNA (dsDNA IgM) ELISA Kit
GA-E0616HM-01 48 Tests

Human anti-double stranded DNA (dsDNA IgM) ELISA Kit

Sign In for Pricing
View Details
Human anti-double stranded DNA (dsDNA IgM) ELISA Kit
GA-E0616HM-02 96 Tests

Human anti-double stranded DNA (dsDNA IgM) ELISA Kit

Sign In for Pricing
View Details
TPD52L2 Human Pre-designed siRNA Set A
HY-RS14930 1 Set

TPD52L2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
NEIL3 antibody
70R-36850 100 ug

NEIL3 antibody

Sign In for Pricing
View Details
Citric Acid
30900014-2 500 g

Citric Acid

Sign In for Pricing
View Details
Olfr792 (NM_001011849) Mouse Tagged ORF Clone
MG226736 10 µg

Olfr792 (NM_001011849) Mouse Tagged ORF Clone

Sign In for Pricing
View Details