Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neuropeptide Y Receptor Y2 (NPY2R) ELISA Kit
RD-NPY2R-Hu-48Tests 48 Tests

Human Neuropeptide Y Receptor Y2 (NPY2R) ELISA Kit

Sign In for Pricing
View Details
Usp43 (BC021474) Mouse Untagged Clone
MC220699 10 µg

Usp43 (BC021474) Mouse Untagged Clone

Sign In for Pricing
View Details
SF3B5 siRNA (Mouse)
CRM6441-01 15 nmol

SF3B5 siRNA (Mouse)

Sign In for Pricing
View Details
SF3B5 siRNA (Mouse)
CRM6441-02 30 nmol

SF3B5 siRNA (Mouse)

Sign In for Pricing
View Details
Poly (diallyldimethylammonium bis (fluorosulfonyl) imide
IL-0362-HP-0100 100 g

Poly (diallyldimethylammonium bis (fluorosulfonyl) imide

Sign In for Pricing
View Details
SLC17A7 Protein Vector (Human) (pPB-N-His)
PV129475 500 ng

SLC17A7 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details