Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCLN antibody
70R-19023 50 ul

OCLN antibody

Sign In for Pricing
View Details
CRTAP (CASP) discontinued
508375 100 µg

CRTAP (CASP) discontinued

Sign In for Pricing
View Details
Maintenance (SCY) Medium
DM 1777 500 g

Maintenance (SCY) Medium

Sign In for Pricing
View Details
GS143 25mg
A22702-25 25 mg

GS143 25mg

Sign In for Pricing
View Details
Mouse Olfactory receptor 10G8 (OR10G8) ELISA Kit
MBS7218729-01 48 Well

Mouse Olfactory receptor 10G8 (OR10G8) ELISA Kit

Sign In for Pricing
View Details
Mouse Olfactory receptor 10G8 (OR10G8) ELISA Kit
MBS7218729-02 96 Well

Mouse Olfactory receptor 10G8 (OR10G8) ELISA Kit

Sign In for Pricing
View Details