Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scgb3a2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7491805 3x 1.0 µg

Scgb3a2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
KIBRA (WWC1) Rabbit Polyclonal Antibody
TA383355 100 µL

KIBRA (WWC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC18 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
48667124 3x 1.0µg DNA

TTC18 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Slc25a41 activation kit by CRISPRa
GA211763 1 Kit

Mouse Slc25a41 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) ATL Polyclonal Antibody
MBS7164060 Inquire

Rabbit anti-Escherichia coli (strain K12) ATL Polyclonal Antibody

Sign In for Pricing
View Details
SYVN1 Protein Vector (Mouse) (pPM-C-HA)
46016025 500 ng

SYVN1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details