Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAG23 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV752050 1.0 µg DNA

TRNAG23 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Mouse Monoclonal MS4A12 Antibody (OTI5F5) [Alexa Fluor 405]
NBP2-72791AF405 0.1 mL

Mouse Monoclonal MS4A12 Antibody (OTI5F5) [Alexa Fluor 405]

Sign In for Pricing
View Details
Sheep anti Chicken TGFbeta receptor III
X1484P 250 µg

Sheep anti Chicken TGFbeta receptor III

Sign In for Pricing
View Details
15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human 3' UTR Clone
SC207745 10 µg

15 Lipoxygenase 2 (ALOX15B) (NM_001141) Human 3' UTR Clone

Sign In for Pricing
View Details
Plasmodium falciparum S antigen (Malaria) (APC) discontinued
P4256-68G-APC 100 µL

Plasmodium falciparum S antigen (Malaria) (APC) discontinued

Sign In for Pricing
View Details
CCNE2 Polyclonal Antibody
RD84236A-01 60μL

CCNE2 Polyclonal Antibody

Sign In for Pricing
View Details