TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)
TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html
Purity
95.00
Smiles
NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS
Molecular Formula
21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)
Molecular Weight
50-75 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
SEMA3G (Sema Domain, Immunoglobulin Domain (Ig), Short Basic Domain, Secreted, (Semaphorin) 3G, FLJ00014, MGC119473, sem2) (AP) discontinued
Troponin I, Cardiac, aa27-40 (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (Biotin)
Troponin I, Cardiac, aa27-40 (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (Biotin)