Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHD3, NT (EHD3, EHD2, PAST3, EH domain-containing protein 3, PAST homolog 3) (FITC) discontinued
034976-FITC 200 µL

EHD3, NT (EHD3, EHD2, PAST3, EH domain-containing protein 3, PAST homolog 3) (FITC) discontinued

Sign In for Pricing
View Details
UBA2 Polyclonal Antibody
ABP52662-01 30 µL

UBA2 Polyclonal Antibody

Sign In for Pricing
View Details
UBA2 Polyclonal Antibody
ABP52662-02 100 µL

UBA2 Polyclonal Antibody

Sign In for Pricing
View Details
UBA2 Polyclonal Antibody
ABP52662-03 200 µL

UBA2 Polyclonal Antibody

Sign In for Pricing
View Details
DL-Boc-pipecolic Acid
TRC-B661955-25G 25 g

DL-Boc-pipecolic Acid

Sign In for Pricing
View Details
GPR175 Rabbit Polyclonal Antibody
ES4762-01 50 µL

GPR175 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details