Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ING4 (Inhibitor of Growth Family, Member 4, MGC12557, my036, p29ING4) (APC)
247658-APC 100 µL

ING4 (Inhibitor of Growth Family, Member 4, MGC12557, my036, p29ING4) (APC)

Sign In for Pricing
View Details
ATP5S Lentiviral Activation Particles (m2)
sc-426904-LAC-2 200 µL

ATP5S Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Mouse Monoclonal PXR/NR1I2 Antibody (V11P4G11*E7) [mFluor Violet 500 SE]
NBP2-50519MFV500 0.1 mL

Mouse Monoclonal PXR/NR1I2 Antibody (V11P4G11*E7) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
P2Y7 HDR Plasmid (h)
sc-403664-HDR 20 µg

P2Y7 HDR Plasmid (h)

Sign In for Pricing
View Details
Rab 41 Polyclonal Antibody
RA29155-01 50 µL

Rab 41 Polyclonal Antibody

Sign In for Pricing
View Details
Rab 41 Polyclonal Antibody
RA29155-02 100 µL

Rab 41 Polyclonal Antibody

Sign In for Pricing
View Details