Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat isocitrate dehydrogenase 3 (IDH3) ELISA Kit
YP-W36952-01 48 Tests

Rat isocitrate dehydrogenase 3 (IDH3) ELISA Kit

Sign In for Pricing
View Details
Rat isocitrate dehydrogenase 3 (IDH3) ELISA Kit
YP-W36952-02 96 Tests

Rat isocitrate dehydrogenase 3 (IDH3) ELISA Kit

Sign In for Pricing
View Details
DUSP22 (Dual Specificity Protein Phosphatase 22, JKAP, JNK-stimulatory Phosphatase-1, JSP1, JSP-1, Low Molecular Weight Dual Specificity Phosphatase 2, LMWDSP2, LMW-DSP2, Mitogen-activated Protein Kinase Phosphatase x, MAP Kinase Phosphatase x, MKPX, MKP-x, VHX) (PE)
126065-PE 100 µL

DUSP22 (Dual Specificity Protein Phosphatase 22, JKAP, JNK-stimulatory Phosphatase-1, JSP1, JSP-1, Low Molecular Weight Dual Specificity Phosphatase 2, LMWDSP2, LMW-DSP2, Mitogen-activated Protein Kinase Phosphatase x, MAP Kinase Phosphatase x, MKPX, MKP-x, VHX) (PE)

Sign In for Pricing
View Details
anti-BSCL2
YF-PA26010 50 ul

anti-BSCL2

Sign In for Pricing
View Details
Human coagulation factor VIIa (FVIIa) ELISA Kit
YP-W18620-01 48 Tests

Human coagulation factor VIIa (FVIIa) ELISA Kit

Sign In for Pricing
View Details
Human coagulation factor VIIa (FVIIa) ELISA Kit
YP-W18620-02 96 Tests

Human coagulation factor VIIa (FVIIa) ELISA Kit

Sign In for Pricing
View Details