Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps26 3'UTR Lenti-reporter-Luc Vector
42293084 1.0 µg

Rps26 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Fortunellin
HY-119678-01 5 mg

Fortunellin

Sign In for Pricing
View Details
Fortunellin
HY-119678-02 10 mg

Fortunellin

Sign In for Pricing
View Details
Protein Kinase A, beta, Catalytic Subunit, phosphorylated (Ser338) (PKAb)
P9102-91K 10 Blots

Protein Kinase A, beta, Catalytic Subunit, phosphorylated (Ser338) (PKAb)

Sign In for Pricing
View Details
GTD2A, CT (GTF2IRD2, GTF2IRD2A, General transcription factor II-I repeat domain-containing protein 2A, Transcription factor GTF2IRD2-alpha) (MaxLight 405) discontinued
036350-ML405 100 µL

GTD2A, CT (GTF2IRD2, GTF2IRD2A, General transcription factor II-I repeat domain-containing protein 2A, Transcription factor GTF2IRD2-alpha) (MaxLight 405) discontinued

Sign In for Pricing
View Details
XKRX sgRNA CRISPR Lentivector set (Human)
K2649201 3x 1.0 µg

XKRX sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details