Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Svs4 Protein Lysate (Rat) with C-HA Tag
45933036 100 µg

Svs4 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rab3a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6846107 1.0 µg DNA

Rab3a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
4-Hydroxy-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzaldehyde
JH183724 1 Each

4-Hydroxy-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzaldehyde

Sign In for Pricing
View Details
Tyrosine Hydroxylase, phosphorylated (Ser31) (TH, TYH, Tyrosine 3 Hydroxylase, Tyrosine 3 Monooxygenase) (FITC) discontinued
T9237-08-FITC 100 µL

Tyrosine Hydroxylase, phosphorylated (Ser31) (TH, TYH, Tyrosine 3 Hydroxylase, Tyrosine 3 Monooxygenase) (FITC) discontinued

Sign In for Pricing
View Details
RalA (Ras-related Protein)
MBS6508198-01 0.1 mg

RalA (Ras-related Protein)

Sign In for Pricing
View Details
RalA (Ras-related Protein)
MBS6508198-02 5x 0.1 mg

RalA (Ras-related Protein)

Sign In for Pricing
View Details