Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsc70 (Hsp73) Antibody: ATTO 390
MBS805240-01 0.1 mL

Hsc70 (Hsp73) Antibody: ATTO 390

Sign In for Pricing
View Details
Hsc70 (Hsp73) Antibody: ATTO 390
MBS805240-02 5x 0.1 mL

Hsc70 (Hsp73) Antibody: ATTO 390

Sign In for Pricing
View Details
Easypro Rat Growth Differentiation Factor 15 (GDF15) ELISA Kit
FY-ER1044S 96 Well

Easypro Rat Growth Differentiation Factor 15 (GDF15) ELISA Kit

Sign In for Pricing
View Details
Canine α-glucosidase (α-Glu) ELISA Kit
EIA05032Ca 1 Kit

Canine α-glucosidase (α-Glu) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human KANK3 shRNA (UAS) - Lentiviral human KANK3 shRNA (UAS) plasmid
GTR15342034 1 Vial

Lentiviral human KANK3 shRNA (UAS) - Lentiviral human KANK3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Herpes Simplex Virus II discontinued
H2033-38G 1 mg

Herpes Simplex Virus II discontinued

Sign In for Pricing
View Details