Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethoxzolamide 5mg
A17359-5 5 mg

Ethoxzolamide 5mg

Sign In for Pricing
View Details
CRISPR Scrambled sgRNA AAV Vector Amp (for saCas9)
K060a 1.0 µg

CRISPR Scrambled sgRNA AAV Vector Amp (for saCas9)

Sign In for Pricing
View Details
SMARCD3 Polyclonal Antibody, FITC Conjugated
bs-9479R-FITC 100 µL

SMARCD3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Vmn1r39 (NM_001166720) Mouse Tagged Lenti ORF Clone
MR223512L4 10 µg

Vmn1r39 (NM_001166720) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FKHR (Phospho-Ser249) Rabbit Polyclonal Antibody
MBS9511885-01 0.05 mL

FKHR (Phospho-Ser249) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FKHR (Phospho-Ser249) Rabbit Polyclonal Antibody
MBS9511885-02 0.1 mL

FKHR (Phospho-Ser249) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details