Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sh3gl1 (NM_013664) Mouse Recombinant Protein
PM42827M5 20 µg

Sh3gl1 (NM_013664) Mouse Recombinant Protein

Sign In for Pricing
View Details
ALKBH5 Knockout A549 Cell Line
ARG43716 1 Million

ALKBH5 Knockout A549 Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal CHD4 Antibody [mFluor Violet 610 SE]
NBP2-99098MFV610 0.1 mL

Rabbit Polyclonal CHD4 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Lin52 3'UTR Luciferase Stable Cell Line
TU111072 1.0 mL

Lin52 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
G6PD Rabbit mAb
A27296-01 20 µL

G6PD Rabbit mAb

Sign In for Pricing
View Details
G6PD Rabbit mAb
A27296-02 100 μL

G6PD Rabbit mAb

Sign In for Pricing
View Details