Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H3A (Ab-28) Antibody
A25036-100UL 100 µL

HIST1H3A (Ab-28) Antibody

Sign In for Pricing
View Details
Pafah1b3 (NM_008776) Mouse Tagged ORF Clone
MG202799 10 µg

Pafah1b3 (NM_008776) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Chlamydia pneumoniae antibody IgG (CPn Ab IgG) ELISA Kit
CK-bio-25272-01 48 Tests

Human Chlamydia pneumoniae antibody IgG (CPn Ab IgG) ELISA Kit

Sign In for Pricing
View Details
Human Chlamydia pneumoniae antibody IgG (CPn Ab IgG) ELISA Kit
CK-bio-25272-02 96 Tests

Human Chlamydia pneumoniae antibody IgG (CPn Ab IgG) ELISA Kit

Sign In for Pricing
View Details
DnaJB6 CRISPR/Cas9 KO Plasmid (h)
sc-404227 20 µg

DnaJB6 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Mmu-miR-878-5p inhibitor
HY-RI04180-01 5 nmol

Mmu-miR-878-5p inhibitor

Sign In for Pricing
View Details