Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU2F1 Protein Vector (Mouse) (pPM-C-HA)
PV218076 500 ng

POU2F1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Gpr172a sgRNA CRISPR Lentivector (Rat) (Target 3)
K6670704 1.0 µg DNA

Gpr172a sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
pLV3-CMV-MIR21-CopGFP-Puro Plasmid
PVT47348 2 µg

pLV3-CMV-MIR21-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
FLJ33360 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV701276 1.0 µg DNA

FLJ33360 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
PROTAC ERRα Degrader-1 5mg
A18910-5 5 mg

PROTAC ERRα Degrader-1 5mg

Sign In for Pricing
View Details
SNAP47 Rabbit Polyclonal Antibody
TA344347 100 µL

SNAP47 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details