TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)
TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html
Purity
95.00
Smiles
NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS
Molecular Formula
21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)
Molecular Weight
50-75 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (MaxLight 490)
Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (MaxLight 490)
