Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAIL R2/TNFRSF10B, Mouse (HEK293, hFc)

TRAIL R2/TNFRSF10B protein is the receptor of TNFSF10/TRAIL and activates apoptosis through FADD-mediated recruitment of caspase-8 to form death-inducing signaling complex (DISC) .It initiates caspase cascade-mediated apoptosis and promotes NF-kappa-B activation, which is critical for ER stress-induced apoptosis.TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived TRAIL R2/TNFRSF10B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TRAIL R2/TNFRSF10B Protein, Mouse (HEK293, hFc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trail-protein-mouse-hek-293-fc.html

Purity

95.00

Smiles

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Molecular Formula

21933 (Gene_ID) Q9QZM4 (N53-S177) (Accession)

Molecular Weight

50-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF805 Protein Vector (Human) (pPM-C-HA)
PV145700 500 ng

ZNF805 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
OSTF1 (Osteoclast Stimulating Factor 1, FLJ20559, OSF, SH3P2, bA235O14.1)
249651 50 µL

OSTF1 (Osteoclast Stimulating Factor 1, FLJ20559, OSF, SH3P2, bA235O14.1)

Sign In for Pricing
View Details
Mouse Monoclonal KIR/CD158 Antibody (MM0438-11G25) [DyLight 755]
NBP2-11758IR 0.1 mL

Mouse Monoclonal KIR/CD158 Antibody (MM0438-11G25) [DyLight 755]

Sign In for Pricing
View Details
GOLM2 Human qPCR Primer Pair (NM_138423)
HP216975 200 Reactions

GOLM2 Human qPCR Primer Pair (NM_138423)

Sign In for Pricing
View Details
CD179a Antibody
E51A08855 100 µL

CD179a Antibody

Sign In for Pricing
View Details
Canine PA-IgG/M/A ELISA Kit
ECP0602 96 Tests

Canine PA-IgG/M/A ELISA Kit

Sign In for Pricing
View Details