Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF RI/TNFRSF1A, Rat (HEK293, His)

TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNFRSF1A Protein, Rat (HEK293, His) is expressed by HEK293 and has a transmembrane region (M1-A211) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNF RI/TNFRSF1A Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf1a-protein-rat-hek293-his.html

Purity

95.00

Smiles

LVPSLGDREKRDNLCPQGKYAHPKNNSICCTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECTPCSHCKKNQECMKLCLPPVANVTNPQDSGTA

Molecular Formula

25625 (Gene_ID) P22934/NP_037223.1 (L30-A211) (Accession)

Molecular Weight

Approximately 30-40 kDa due to glycosylation

References & Citations

[1]Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10 (1) :45-65.|[2]Fu Q, et, al. miR-29a up-regulation in AR42J cells contributes to apoptosis via targeting TNFRSF1A gene. World J Gastroenterol. 2016 May 28;22 (20) :4881-90.|[3]Zhou S, et, al. Bioinformatics Analysis Identifies TNFRSF1A as a Biomarker of Liver Injury in Sepsis TNFRSF1A is a Biomarker for Septic Liver Injury. Genet Res (Camb) . 2022 Oct 15;2022:1493744.|[4]Egusquiaguirre SP, et, al. The STAT3 Target Gene TNFRSF1A Modulates the NF-κB Pathway in Breast Cancer Cells. Neoplasia. 2018 May;20 (5) :489-498.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Visual Arrestin Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2381284 100 µL

Visual Arrestin Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
RGS10 (Regulator of G-protein Signaling 10, RGS10, RGS10)
407016-01 50 µL

RGS10 (Regulator of G-protein Signaling 10, RGS10, RGS10)

Sign In for Pricing
View Details
RGS10 (Regulator of G-protein Signaling 10, RGS10, RGS10)
407016-02 100 µL

RGS10 (Regulator of G-protein Signaling 10, RGS10, RGS10)

Sign In for Pricing
View Details
Pempidine HCl
T68992-01 25 mg

Pempidine HCl

Sign In for Pricing
View Details
Pempidine HCl
T68992-02 50 mg

Pempidine HCl

Sign In for Pricing
View Details
Pempidine HCl
T68992-03 100 mg

Pempidine HCl

Sign In for Pricing
View Details