Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLE3, Human (His)

The TLE3 protein is a transcriptional corepressor that inhibits Wnt signaling by binding to transcription factors such as CTNNB1 and TCF family members. It forms homotetramers, hetero-oligomers, and interacts with AES.TLE3 Protein, Human (His) is the recombinant human-derived TLE3 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

TLE3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tle3-protein-human-gst.html

Purity

98.0

Smiles

SHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY

Molecular Formula

7090 (Gene_ID) Q04726 (S484-Y772) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)
MBS2036387-01 0.1 mL

PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)
MBS2036387-02 0.2 mL

PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)
MBS2036387-03 0.5 mL

PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)
MBS2036387-04 1 mL

PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)
MBS2036387-05 5 mL

PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)
MBS2036387-06 5x 5 mL

PE-Linked Polyclonal Antibody to Interleukin 12A (IL12A)

Sign In for Pricing
View Details