Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRP1, Human (HEK293, His)

TRP1 (tyrosinase-related protein 1) is critical in melanin biosynthesis and catalyzes the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) to indole-5,6-quinone-2- Carboxylic acids, especially in the presence of Cu (2+) ions. This activity is inhibited by Zn (2+) . TRP1 Protein, Human (HEK293, His) is the recombinant human-derived TRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trp1-protein-human-hek293-his.html

Purity

95.00

Smiles

QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSR

Molecular Formula

7306 (Gene_ID) P17643 (Q25-R471) (Accession)

Molecular Weight

Approximately 60-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-500 1x 500 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TS106), CF740 conjugate, 0.1mg/mL
BNC740714-500 1x 500 µL

Thymidylate Synthase (TS106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Heparan Sulphate Proteoglycan (A7L6), CF405S conjugate, 0.1mg/mL
BNC040315-100 1x 100 µL

Heparan Sulphate Proteoglycan (A7L6), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details