Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRP1, Human (HEK293, His)

TRP1 (tyrosinase-related protein 1) is critical in melanin biosynthesis and catalyzes the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) to indole-5,6-quinone-2- Carboxylic acids, especially in the presence of Cu (2+) ions. This activity is inhibited by Zn (2+) . TRP1 Protein, Human (HEK293, His) is the recombinant human-derived TRP1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TRP1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trp1-protein-human-hek293-his.html

Purity

95.00

Smiles

QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSR

Molecular Formula

7306 (Gene_ID) P17643 (Q25-R471) (Accession)

Molecular Weight

Approximately 60-75 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Phosphate Monobasic
GC105001-500g 500 g

Sodium Phosphate Monobasic

Sign In for Pricing
View Details
TAPBPL Antibody, FITC conjugated
CSB-PA887144LC01HU-01 50 µg

TAPBPL Antibody, FITC conjugated

Sign In for Pricing
View Details
TAPBPL Antibody, FITC conjugated
CSB-PA887144LC01HU-02 100 µg

TAPBPL Antibody, FITC conjugated

Sign In for Pricing
View Details
2- ([1,1'-Biphenyl]-3-yl) propan-2-ol
OR1093514-01 250 mg

2- ([1,1'-Biphenyl]-3-yl) propan-2-ol

Sign In for Pricing
View Details
2- ([1,1'-Biphenyl]-3-yl) propan-2-ol
OR1093514-02 500 mg

2- ([1,1'-Biphenyl]-3-yl) propan-2-ol

Sign In for Pricing
View Details
2- ([1,1'-Biphenyl]-3-yl) propan-2-ol
OR1093514-03 1 g

2- ([1,1'-Biphenyl]-3-yl) propan-2-ol

Sign In for Pricing
View Details