Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF-4, Human (His)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. Animal-Free FGF-4 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-4 protein, expressed by E. coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF-4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-4-protein-human-his.html

Purity

95.0

Smiles

MGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (G25-L206) (Accession)

Molecular Weight

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal dsDNA Antibody (DSD/4054R) [Alexa Fluor 532]
NBP3-08490AF532 0.1 mL

Rabbit Monoclonal dsDNA Antibody (DSD/4054R) [Alexa Fluor 532]

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)
MBS1360748-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)
MBS1360748-02 0.02 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)
MBS1360748-03 0.1 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)
MBS1360748-04 0.1 mg (Yeast)

Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)
MBS1360748-05 0.02 mg (Baculovirus)

Recombinant Shigella flexneri serotype 5b Protein FdhE (fdhE)

Sign In for Pricing
View Details