Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNL4A, Human (His)

The TXNL4A protein plays a key role in pre-mRNA splicing and is an important component of U5 snRNP, U4/U6-U5 tri-snRNP complex, and precatalytic spliceosome (spliceosome B complex) . It contributes to spliceosome assembly and is an integral part of the complex process of spliceosome function. TXNL4A Protein, Human (His) is the recombinant human-derived TXNL4A protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TXNL4A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/txnl4a-protein-human-his.html

Purity

97.00

Smiles

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Molecular Formula

10907 (Gene_ID) P83876 (M1-Y142) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS Coronavirus Monoclonal Antibody
MBS5316484-01 1 mg

SARS Coronavirus Monoclonal Antibody

Sign In for Pricing
View Details
SARS Coronavirus Monoclonal Antibody
MBS5316484-02 5x 1 mg

SARS Coronavirus Monoclonal Antibody

Sign In for Pricing
View Details
Gas8 shRNA (m) Lentiviral Particles
sc-75108-V 200 µL

Gas8 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (MaxLight 405)
MBS6191536-01 0.1 mL

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (MaxLight 405)

Sign In for Pricing
View Details
NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (MaxLight 405)
MBS6191536-02 5x 0.1 mL

NUDC (Nuclear Migration Protein nudC, Nuclear Distribution Protein C Homolog) (MaxLight 405)

Sign In for Pricing
View Details
Sulf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7020007 1.0 µg DNA

Sulf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details